<?xml version="1.0" encoding="UTF-8"?>
<urlset xmlns="http://www.sitemaps.org/schemas/sitemap/0.9" xmlns:image="http://www.google.com/schemas/sitemap-image/1.1">
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-11-5-55_product_1_1641965755549.jpg?v=1641965771</image:loc>
      <image:title>Red Faceted Rondelle Crystal Czech Glass Beads- 10x14 mm</image:title>
      <image:caption>crystal-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads-1</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-11-11-16_product_1_1641966076441.jpg?v=1641966088</image:loc>
      <image:title>Red Faceted Oval Crystal Czech Glass Beads- 12x16 mm</image:title>
      <image:caption>crystal-glass-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads-2</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-11-15-25_product_1_1641966325682.jpg?v=1641966342</image:loc>
      <image:title>Green Transparent Bicone Crystal Czech Glass Beads - 8 mm</image:title>
      <image:caption>crystal-glass-beads-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads-3</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-11-24-13_product_1_1641966853319.jpg?v=1641966871</image:loc>
      <image:title>Green Transparent Rondelle Crystal  Czech Glass Beads - 14x18 mm</image:title>
      <image:caption>crystal-glass-beads-3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads-4</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-11-29-20_product_1_1641967160089.jpg?v=1641967171</image:loc>
      <image:title>Green Transparent Rondelle Crystal Czech Glass Beads - 12x16 mm</image:title>
      <image:caption>crystal-glass-beads-4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads-6</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-11-34-35_product_1_1641967475785.jpg?v=1641967486</image:loc>
      <image:title>Green Transparent Rondelle Crystal Czech Glass Beads - 9x12 mm</image:title>
      <image:caption>crystal-glass-beads-6</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads-8</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-11-41-29_product_1_1641967889991.jpg?v=1641967899</image:loc>
      <image:title>Green Rondelle Faceted Crystal Czech Glass Beads - 8x10 mm</image:title>
      <image:caption>crystal-glass-beads-8</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads-9</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-11-49-10_product_1_1641968350129.jpg?v=1641968364</image:loc>
      <image:title>Green Rondelle Faceted Crystal Czech Glass Beads - 6x8 mm</image:title>
      <image:caption>crystal-glass-beads-9</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads-10</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-11-58-2_product_1_1641968882374.jpg?v=1641968892</image:loc>
      <image:title>Dark Green Rondelle Faceted Crystal Czech Glass Beads - 9x12 mm</image:title>
      <image:caption>crystal-glass-beads-10</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads-14</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-12-19-26_product_1_1641970166447.jpg?v=1641970176</image:loc>
      <image:title>Blue Faceted Spherical Crystal Czech Glass Beads - 4x6 mm</image:title>
      <image:caption>crystal-glass-beads-14</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads-15</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-12-22-24_product_1_1641970344526.jpg?v=1641970357</image:loc>
      <image:title>Light Blue Spherical Faceted Crystal Czech Glass Beads - 4x6 mm</image:title>
      <image:caption>crystal-glass-beads-15</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads-17</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-12-30-23_product_1_1641970823067.jpg?v=1641970834</image:loc>
      <image:title>Dark Blue Spherical Faceted Crystal Czech Glass Beads - 8x10 mm</image:title>
      <image:caption>crystal-glass-beads-17</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads-18</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-13-30-28_product_1_1641974428222.jpg?v=1641974443</image:loc>
      <image:title>Dark Blue Faceted Spherical Crystal Czech Glass Beads - 9x12 mm</image:title>
      <image:caption>crystal-glass-beads-18</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads-21</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-13-39-44_product_1_1641974984638.jpg?v=1641974999</image:loc>
      <image:title>Dark Maroon Spherical Faceted Crystal Czech Glass Beads - 12x16 mm</image:title>
      <image:caption>crystal-glass-beads-21</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/grey-chanderi-with-white-thread-golden-sequins-embroidered-motifs</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-13-45-21_product_1_1641975321923.jpg?v=1641975339</image:loc>
      <image:title>Gray White Thread and Golden Sequins Flowers Embroidered Chanderi Fabric</image:title>
      <image:caption>grey-chanderi-with-white-thread-golden-sequins-embroidered-motifs</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads-22</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-13-45-44_product_1_1641975344906.jpg?v=1641975358</image:loc>
      <image:title>Red Faceted Spherical Crystal Czech Glass Beads - 9x12 mm</image:title>
      <image:caption>crystal-glass-beads-22</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads-23</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-13-49-7_product_1_1641975547292.jpg?v=1641975559</image:loc>
      <image:title>Maroon Spherical Faceted Crystal Czech Glass Beads - 8 mm</image:title>
      <image:caption>crystal-glass-beads-23</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-chanderi-with-rose-gold-gota-patti-embroidery</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-13-50-54_product_1_1641975654067.jpg?v=1641975670</image:loc>
      <image:title>White Rose Golden Geometric Stripes Gota Patti Embroidered Chanderi Fabric</image:title>
      <image:caption>white-chanderi-with-rose-gold-gota-patti-embroidery</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/rani-pink-georgette-with-white-embroidered-chikankari-work</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-13-55-40_product_1_1641975940709.jpg?v=1641975957</image:loc>
      <image:title>Magenta Pink White Flowers Chikankari Embroidered Georgette Fabric</image:title>
      <image:caption>rani-pink-georgette-with-white-embroidered-chikankari-work</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/mauve-pink-chanderi-with-multicolored-cross-stitch-embroidery</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-14-1-11_product_1_1641976271316.jpg?v=1641976286</image:loc>
      <image:title>Mauve Pink Multicolour Flowers Embroidered Chanderi Fabric</image:title>
      <image:caption>mauve-pink-chanderi-with-multicolored-cross-stitch-embroidery</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/off-white-chanderi-silk-with-kashmiri-zari-embroidered-motifs-allover</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-14-7-18_product_1_1641976638612.jpg?v=1641976658</image:loc>
      <image:title>Off White Pink Floral Motifs Kashmiri Zari Embroidered Chanderi Silk Fabric</image:title>
      <image:caption>off-white-chanderi-silk-with-kashmiri-zari-embroidered-motifs-allover</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-self-patterned-geometric-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-14-11-53_product_1_1641976913836.jpg?v=1757675595</image:loc>
      <image:title>White Geometric Self Pattern Cotton Fabric</image:title>
      <image:caption>white-self-patterned-geometric-cotton-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads-24</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-14-35-32_product_1_1641978332766.jpg?v=1641978344</image:loc>
      <image:title>Red Faceted Spherical Crystal Czech Glass Beads - 8x10 mm</image:title>
      <image:caption>crystal-glass-beads-24</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads-25</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-14-40-29_product_1_1641978629573.jpg?v=1641978643</image:loc>
      <image:title>Bright Red Faceted Spherical Crystal Czech Glass Beads - 8x10 mm</image:title>
      <image:caption>crystal-glass-beads-25</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads-26</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-14-47-12_product_1_1641979032345.jpg?v=1641979044</image:loc>
      <image:title>Red Spherical Faceted Crystal Czech Glass Beads - 6x8 mm</image:title>
      <image:caption>crystal-glass-beads-26</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads-27</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-14-54-15_product_1_1641979455833.jpg?v=1641979466</image:loc>
      <image:title>Dark Red Rondelle Faceted Crystal Czech Glass Beads - 4x6 mm</image:title>
      <image:caption>crystal-glass-beads-27</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads-28</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-15-35-1_product_1_1641981901099.jpg?v=1641981912</image:loc>
      <image:title>Red Bicone Faceted Crystal Czech Glass Beads - 4 mm</image:title>
      <image:caption>crystal-glass-beads-28</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads-29</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-15-37-27_product_1_1641982047039.jpg?v=1641982057</image:loc>
      <image:title>Bright Red Bicone Faceted Crystal Czech Glass Beads - 4 mm</image:title>
      <image:caption>crystal-glass-beads-29</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads-30</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-15-41-38_product_1_1641982298018.jpg?v=1641982309</image:loc>
      <image:title>Red Faceted Rondelle Crystal Czech Glass Beads - 3x4 mm</image:title>
      <image:caption>crystal-glass-beads-30</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads-31</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-15-57-27_product_1_1641983247199.jpg?v=1641983259</image:loc>
      <image:title>Orange Faceted Rondelle Crystal Czech Glass Beads - 10x14 mm</image:title>
      <image:caption>crystal-glass-beads-31</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads-32</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-16-0-32_product_1_1641983432713.jpg?v=1641983445</image:loc>
      <image:title>Orange Faceted Rondelle Crystal Czech Glass Beads - 9x12 mm</image:title>
      <image:caption>crystal-glass-beads-32</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads-33</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-16-4-34_product_1_1641983674077.jpg?v=1641983685</image:loc>
      <image:title>Orange Faceted Rondelle Crystal Czech Glass Beads - 8x10 mm</image:title>
      <image:caption>crystal-glass-beads-33</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads-34</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-16-8-59_product_1_1641983939932.jpg?v=1641983951</image:loc>
      <image:title>Orange Faceted Rondelle Crystal Beads - 6x8 mm</image:title>
      <image:caption>crystal-glass-beads-34</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads-35</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-16-11-43_product_1_1641984103024.jpg?v=1641984115</image:loc>
      <image:title>Orange Faceted Rondelle Crystal Czech Glass Beads - 4x6 mm</image:title>
      <image:caption>crystal-glass-beads-35</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-glass-beads-36</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-16-15-22_product_1_1641984322241.jpg?v=1641984334</image:loc>
      <image:title>Yellow Faceted Bicone Crystal Czech Glass Beads - 4 mm</image:title>
      <image:caption>crystal-glass-beads-36</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transparent-golden-glass-beads-3mm</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-16-25-0_product_1_1641984900238.jpg?v=1748249042</image:loc>
      <image:title>Golden Transparent Circular Glass Beads- 3mm</image:title>
      <image:caption>transparent-golden-glass-beads-3mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transparent-golden-glass-beads-10mm</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-16-36-26_product_1_1641985586762.jpg?v=1748249038</image:loc>
      <image:title>Golden Transparent Circular Glass Beads- 10mm</image:title>
      <image:caption>transparent-golden-glass-beads-10mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transparent-golden-glass-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-16-37-26_product_1_1641985646043.jpg?v=1748249034</image:loc>
      <image:title>Golden Transparent Circular Glass Beads- 4mm</image:title>
      <image:caption>transparent-golden-glass-beads-4mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transparent-golden-glass-beads-6-mm</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-12-16-42-0_product_1_1641985920161.jpg?v=1748249028</image:loc>
      <image:title>Golden Transparent Circular Glass Beads- 6 mm</image:title>
      <image:caption>transparent-golden-glass-beads-6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-multicolor-check-pure-cotton-handloom-fabric</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-13-1-9-34_product_1_1642016374371.jpg?v=1642016388</image:loc>
      <image:title>Yellow Multicolour Check Pure Cotton Handloom Fabric</image:title>
      <image:caption>yellow-multicolor-check-pure-cotton-handloom-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-black-self-striped-rayon-fabric</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-14-13-35-53_product_1_1642147553130.jpg?v=1642147578</image:loc>
      <image:title>Blue Black Self Stripes Rayon Fabric</image:title>
      <image:caption>blue-black-self-striped-rayon-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cobalt-blue-self-weaved-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-14-13-44-15_product_1_1642148055129.jpg?v=1763816195</image:loc>
      <image:title>Cobalt Blue Geometric Self Weaved Cotton Fabric</image:title>
      <image:caption>cobalt-blue-self-weaved-cotton-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/mustard-tilak-printed-self-weaved-cotton</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-14-13-53-59_product_1_1642148639652.jpg?v=1642148657</image:loc>
      <image:title>Mustard Yellow Geometric Printed Self Weaved Cotton</image:title>
      <image:caption>mustard-tilak-printed-self-weaved-cotton</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/grey-chanderi-with-white-lakhnavi-sequinned-motifs-allover</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-14-14-5-31_product_1_1642149331061.jpg?v=1642149348</image:loc>
      <image:title>Gray White Floral Motifs Lakhnawi Embroidered Chanderi Fabric</image:title>
      <image:caption>grey-chanderi-with-white-lakhnavi-sequinned-motifs-allover</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/geometricalprintedwoodenbuttons1</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/019bae7c80f863218868fe2e50987301.jpg?v=1642152964</image:loc>
      <image:title>Mustard Fancy Geometric Printed 2 Hole Wooden Buttons - 32L</image:title>
      <image:caption>Geometrical Printed Wooden Buttons 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/geometricalprintedwoodenbuttons2</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/5859f8823edea5e3684fbdafd576edab.jpg?v=1642152999</image:loc>
      <image:title>Mustard Fancy Geometrical Printed 2 Hole Wooden Buttons - 32L</image:title>
      <image:caption>Geometrical Printed Wooden Buttons 2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/floralprintedwoodenbuttons1</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/72a4a24ae1c24d716ca245a602d22a54.jpg?v=1642153032</image:loc>
      <image:title>Mustard Fancy Flowers Printed 2 Hole Wooden Buttons - 32L</image:title>
      <image:caption>Floral Printed Wooden Buttons 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/starprintedwoodenbuttons1</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d17addaa4aad035d2869ef26cb52af49.jpg?v=1642153063</image:loc>
      <image:title>Mustard Fancy Stars Printed 2 Hole Wooden Buttons - 32L</image:title>
      <image:caption>Star Printed Wooden Buttons 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/starprintedwoodenbuttons2</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/99a7e5e0205e840a4f55bce5b779d8ff.jpg?v=1642153097</image:loc>
      <image:title>Mustard Designer Stars Printed 2 Hole Wooden Buttons - 32L</image:title>
      <image:caption>Star Printed Wooden Buttons 2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/anchorprintedwoodenbuttons</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cd21ad02575151b9909206f260af2f74.jpg?v=1642153132</image:loc>
      <image:title>Mustard Designer Anchor Printed 2 Hole Wooden Buttons - 32L</image:title>
      <image:caption>Anchor Printed Wooden Buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/floralprintedwoodenbuttons2</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/663f560c9e05d78dd7142cca42297b58.jpg?v=1642153163</image:loc>
      <image:title>Mustard Fancy Floral Printed 2 Hole Wooden Buttons - 32L</image:title>
      <image:caption>Floral Printed Wooden Buttons 2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/geometricalprintedwoodenbuttons3</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/897c78f4f5c0721962172e353813515f.jpg?v=1642153196</image:loc>
      <image:title>Mustard Fancy Geometric Printed 2 Hole Wooden Buttons - 32L</image:title>
      <image:caption>Geometrical Printed Wooden Buttons 3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/geometricalprintedwoodenbuttons4</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/f6cf618202a02774ede98ecc320ab361.jpg?v=1642153235</image:loc>
      <image:title>Mustard Geometric Floral Printed 2 Hole Wooden Buttons - 32L</image:title>
      <image:caption>Geometrical Printed Wooden Buttons 4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/geometricalprintedwoodenbuttons5</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c942b4cfdfdcd220296db95fb39aea44.jpg?v=1642153272</image:loc>
      <image:title>Mustard Designer Geometric Printed 2 Hole Wooden Buttons - 32L</image:title>
      <image:caption>Geometrical Printed Wooden Buttons 5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/floralprintedwoodenbuttons3</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6bc7ac0a76e616d734906e66d115bbbd.jpg?v=1642153308</image:loc>
      <image:title>Mustard Designer Floral Printed 2 Hole Wooden Buttons - 32L</image:title>
      <image:caption>Floral Printed Wooden Buttons 3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/abstractprintedwoodenbuttons1</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d08e961ef1555559530f2dbb052119f1.jpg?v=1642153344</image:loc>
      <image:title>Mustard Designer Abstract 1 Printed 2 Hole Wooden Buttons - 32L</image:title>
      <image:caption>Abstract Printed Wooden Buttons 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/abstractprintedwoodenbuttons2</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/8db960624ea745a3b2a447f693d20646.jpg?v=1642153374</image:loc>
      <image:title>Mustard Designer Abstract Printed 2 Hole Wooden Buttons - 32L</image:title>
      <image:caption>Abstract Printed Wooden Buttons 2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/floralprintedwoodenbuttons4</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/ca338588cabc8c9892dbcbd4bf76e865.jpg?v=1642153412</image:loc>
      <image:title>Mustard Designer Floral Printed 2 Hole Wooden Buttons - 32L</image:title>
      <image:caption>Floral Printed Wooden Buttons 4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/abstractprintedwoodenbuttons3</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/3f1fcf06491ce710bfcf67332ad439c7.jpg?v=1642153442</image:loc>
      <image:title>Mustard Designer Geometric Printed 2 Hole Wooden Buttons - 32L</image:title>
      <image:caption>Abstract Printed Wooden Buttons 3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/geometricalprintedwoodenbuttons6</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/987c685b773fdff6b160f91235220fa7.jpg?v=1642153473</image:loc>
      <image:title>Mustard Geometric Fancy  Printed 2 Hole Wooden Buttons - 32L</image:title>
      <image:caption>Geometrical Printed Wooden Buttons 6</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/floralprintedwoodenbuttons5</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/e3d6b16639086b35c48eac4daf66ba6b.jpg?v=1642153527</image:loc>
      <image:title>Mustard Floral Printed 2 Hole Wooden Buttons - 32L</image:title>
      <image:caption>Floral Printed Wooden Buttons 5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/appleprintedwoodenbuttons</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1aca1d5db5d4859c0892fc2f399b8f76.jpg?v=1642153584</image:loc>
      <image:title>Mustard Apples Printed 2 Hole Wooden Buttons - 32L</image:title>
      <image:caption>Apple Printed Wooden Buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/geometricalprintedwoodenbuttons7</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2a563a7804189ee66bbaa29cc374e788.jpg?v=1642153615</image:loc>
      <image:title>Mustard Geometric Printed 2 Hole Wooden Buttons - 32L</image:title>
      <image:caption>Geometrical Printed Wooden Buttons 7</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/floral-printed-wooden-buttons-7</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-14-15-40-39_product_1_1642155039767.jpg?v=1642155045</image:loc>
      <image:title>Light Yellow Floral Printed Wooden Buttons</image:title>
      <image:caption>floral-printed-wooden-buttons-7</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/geometriccircles2holewoodenbuttons1</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/ac9edc6902318e9e8290bda2b18db975.jpg?v=1642155967</image:loc>
      <image:title>Mustard Fancy Geometric 2 Hole Wooden Buttons - 60L</image:title>
      <image:caption>Geometric Circles 2 Hole Wooden Buttons 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/geometrictriangle2holewoodenbuttons</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1e376d52eb3e919698a03367ec7fc7ad.jpg?v=1642156019</image:loc>
      <image:title>Mustard Triangles 2 Hole Wooden Buttons - 60L</image:title>
      <image:caption>Geometric Triangle 2 Hole Wooden Buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/geometriccircles2holewoodenbuttons3</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/52148eab445f7b4bddb89958aab173d1.jpg?v=1642156053</image:loc>
      <image:title>Mustard Designer Geometric 2 Hole Wooden Buttons - 60L</image:title>
      <image:caption>Geometric Circles 2 Hole Wooden Buttons 3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/geometriccircles2holewoodenbuttons4</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/0c69862c02e35fa063c7c3efcb60529e.jpg?v=1642156087</image:loc>
      <image:title>Mustard Geometric Circles 2 Hole Wooden Buttons - 60L</image:title>
      <image:caption>Geometric Circles 2 Hole Wooden Buttons 4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/geometricalabstract2holewoodenbuttons2</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2ffb6be8a63782549cc48deca6336154.jpg?v=1642156162</image:loc>
      <image:title>Mustard Geometric Abstract 2 Hole Wooden Buttons - 60L</image:title>
      <image:caption>Geometrical Abstract 2 Hole Wooden Buttons 2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/geometricalstar2holewoodenbuttons</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/4e6a36c76063ff2e258cda5d5d508c08.jpg?v=1642156196</image:loc>
      <image:title>Mustard Stars 2 Hole Wooden Buttons - 60L</image:title>
      <image:caption>Geometrical Star 2 Hole Wooden Buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/geometriccircles2holewoodenbuttons5</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/e185b0a97e52027da27a39c749052435.jpg?v=1642156232</image:loc>
      <image:title>Mustard Geometric Circles 2 Hole Wooden Buttons - 60L</image:title>
      <image:caption>Geometric Circles 2 Hole Wooden Buttons 5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/geometriccircles2holewoodenbuttons6</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d04901be817a46fc0e914379b2650eb6.jpg?v=1642156265</image:loc>
      <image:title>Mustard Geometric 2 Hole Wooden Buttons - 60L</image:title>
      <image:caption>Geometric Circles 2 Hole Wooden Buttons 6</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/floral2holewoodenbuttons1</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c4ba389aff7963841d7a692d3394e5b1.jpg?v=1642156299</image:loc>
      <image:title>Mustard Floral 2 Hole Wooden Buttons - 60L</image:title>
      <image:caption>Floral 2 Hole Wooden Buttons 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/starprinted2holewoodenbuttons1</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9f690d98bccb17eec177cc388b61b560.jpg?v=1642156928</image:loc>
      <image:title>Mustard Stars Printed 2 Hole Wooden Buttons - 24L</image:title>
      <image:caption>Star Printed 2 Hole Wooden Buttons 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/circularprinted2holewoodenbuttons1</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/bcc6ddaa36c071909fb8abf3a0c3d6da.jpg?v=1642156965</image:loc>
      <image:title>Mustard Circular Printed 2 Hole Wooden Buttons - 24L</image:title>
      <image:caption>Circular Printed 2 Hole Wooden Buttons 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/abstractprinted2holewoodenbuttons1</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/e08b6589f5f5e09f00b805a45449ebf2.jpg?v=1642156997</image:loc>
      <image:title>Mustard Abstract 2 Printed 2 Hole Wooden Buttons - 24L</image:title>
      <image:caption>Abstract Printed 2 Hole Wooden Buttons 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/abstractprinted2holewoodenbuttons2</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/14764aa2eaf6084267d956df76eb3068.jpg?v=1642157031</image:loc>
      <image:title>Mustard Abstract Printed 2 Hole Wooden Buttons - 24L</image:title>
      <image:caption>Abstract Printed 2 Hole Wooden Buttons 2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/circularprinted2holewoodenbuttons2</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/f0a03e52c8a59e281fd25281f590d1c6.jpg?v=1642157069</image:loc>
      <image:title>Mustard Fancy Geometric Printed 2 Hole Wooden Buttons - 24L</image:title>
      <image:caption>Circular Printed 2 Hole Wooden Buttons 2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/floralprinted2holewoodenbuttons1</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c728ae9d3fc1a3fdc341b41d20447949.jpg?v=1642157100</image:loc>
      <image:title>Mustard Floral 1 Printed 2 Hole Wooden Buttons - 24L</image:title>
      <image:caption>Floral Printed 2 Hole Wooden Buttons 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/floralprinted2holewoodenbuttons2</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/116e44d796ff09f8f9b055d2a5883227.jpg?v=1642157131</image:loc>
      <image:title>Mustard Flower 2 Printed 2 Hole Wooden Buttons - 24L</image:title>
      <image:caption>Floral Printed 2 Hole Wooden Buttons 2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/geometricaldesignprinted2holewoodenbuttons1</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/00495829dc5f81c59f760f8c0b1b8b1a.jpg?v=1642157162</image:loc>
      <image:title>Mustard Geometric Star Printed 2 Hole Wooden Buttons - 24L</image:title>
      <image:caption>Geometrical Design Printed 2 Hole Wooden Buttons 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/geometricaldesignprinted2holewoodenbuttons2</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a65b60d5105633a3e168dad2be947e0c.jpg?v=1642157195</image:loc>
      <image:title>Mustard Fancy Geometric Printed 2 Hole Wooden Buttons - 24L</image:title>
      <image:caption>Geometrical Design Printed 2 Hole Wooden Buttons 2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/floralprinted2holewoodenbuttons3</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d0f7da582adbf13a8304294b9ea3b3db.jpg?v=1642157227</image:loc>
      <image:title>Mustard Flower Printed 2 Hole Wooden Buttons - 24L</image:title>
      <image:caption>Floral Printed 2 Hole Wooden Buttons 3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/floralprinted2holewoodenbuttons4</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c8ed199708283f5ba516e1eae9164f4f.jpg?v=1642157256</image:loc>
      <image:title>Mustard Designer Floral Printed 2 Hole Wooden Buttons - 24L</image:title>
      <image:caption>Floral Printed 2 Hole Wooden Buttons 4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/floralprinted2holewoodenbuttons5</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d460840d604241bcb1c8902f6da5904d.jpg?v=1642157286</image:loc>
      <image:title>Mustard Floral Printed 2 Hole Wooden Buttons - 24L</image:title>
      <image:caption>Floral Printed 2 Hole Wooden Buttons 5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/geometricaldesignprinted2holewoodenbuttons3</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/abf753c6f11f634c508d288db5025425.jpg?v=1642157317</image:loc>
      <image:title>Mustard Designer Geometric Printed 2 Hole Wooden Buttons - 24L</image:title>
      <image:caption>Geometrical Design Printed 2 Hole Wooden Buttons 3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/geometricaldesignprinted2holewoodenbuttons4</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/f43ce3edd94ccfc08d06c50f8b305e9d.jpg?v=1642157350</image:loc>
      <image:title>Mustard Geometric Printed 2 Hole Wooden Buttons - 24L</image:title>
      <image:caption>Geometrical Design Printed 2 Hole Wooden Buttons 4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/appleprinted2holewoodenbuttons</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a9b38967b25256c201d8ef422e291005.jpg?v=1642157380</image:loc>
      <image:title>Mustard Apples Printed 2 Hole Wooden Buttons - 24L</image:title>
      <image:caption>Apple Printed 2 Hole Wooden Buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/geometricaldesignprinted2holewoodenbuttons5</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/8026f58806c9e2207b6a7a7fd23c1b71.jpg?v=1642157411</image:loc>
      <image:title>Mustard Fancy 1 Printed 2 Hole Wooden Buttons - 24L</image:title>
      <image:caption>Geometrical Design Printed 2 Hole Wooden Buttons 5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/geometriccircleprinted2holewoodenbuttons6</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a38afb02c68bb43d8e23459c46819338.jpg?v=1642157450</image:loc>
      <image:title>Mustard Fancy Printed 2 Hole Wooden Buttons - 24L</image:title>
      <image:caption>Geometric Circle Printed 2 Hole Wooden Buttons 6</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/geometricdropprinted2holewoodenbuttons7</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/3745c2bbed34ab9611ef177f2b83b1a1.jpg?v=1642157481</image:loc>
      <image:title>Mustard Designer Printed 2 Hole Wooden Buttons - 24L</image:title>
      <image:caption>Geometric Drop Printed 2 Hole Wooden Buttons 7</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/starprinted2holewoodenbuttons2</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/72cc69cb15038bb65ca990ac151315f4.jpg?v=1642157518</image:loc>
      <image:title>Mustard Star Printed 2 Hole Wooden Buttons - 24L</image:title>
      <image:caption>Star Printed 2 Hole Wooden Buttons 2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/whitegoldendesignerbrooch1</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/825995c59044dad73be5fc6b96e250ad.jpg?v=1642157675</image:loc>
      <image:title>White Golden Designer Brooch 1</image:title>
      <image:caption>White Golden Designer Brooch 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/whitegoldendesignerbrooch2</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/fba8aa5c3c17d276f200e115b40e622b.jpg?v=1642157695</image:loc>
      <image:title>White Golden Designer Brooch 2</image:title>
      <image:caption>White Golden Designer Brooch 2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/whitegoldendesignerbrooch3</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c7ba04d3da8e78b875d466c9b790b05b.jpg?v=1642157712</image:loc>
      <image:title>White Golden Designer Brooch</image:title>
      <image:caption>White Golden Designer Brooch 3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/whitegoldendesignerbrooch4</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/bee3e7d7f0a4b6991ab1c8894bff346f.jpg?v=1642157729</image:loc>
      <image:title>White Golden Designer Brooch 4</image:title>
      <image:caption>White Golden Designer Brooch 4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/whitegoldendesignerbrooch5</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/7684a563e9a457510ff0cc892083e5c2.jpg?v=1642157750</image:loc>
      <image:title>White Golden Designer Brooch 5</image:title>
      <image:caption>White Golden Designer Brooch 5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/whitegoldendesignerbrooch6</loc>
    <lastmod>2026-04-10T12:25:23+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/10084bb54ba5285947bf46ebca09c290.jpg?v=1642157767</image:loc>
      <image:title>White Golden Designer Brooch 6</image:title>
      <image:caption>White Golden Designer Brooch 6</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/whitegoldendesignerbrooch7</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/f679f25179814a03d2411c5359ac092e.jpg?v=1642157784</image:loc>
      <image:title>White Golden Designer Brooch 7</image:title>
      <image:caption>White Golden Designer Brooch 7</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/whitegoldendesignerbrooch8</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/80fc607dffa2adca52e3ff6d955bb23d.jpg?v=1642157802</image:loc>
      <image:title>White Golden Designer Brooch 8</image:title>
      <image:caption>White Golden Designer Brooch 8</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/whitegoldendesignerbrooch9</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/b2b113352935b885ee7a8c718909d6f7.jpg?v=1642157820</image:loc>
      <image:title>White Golden Designer Brooch 9</image:title>
      <image:caption>White Golden Designer Brooch 9</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/whitegoldendesignerbrooch10</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/4792e22047df1f87a9acf89b7fbc5b95.jpg?v=1642157842</image:loc>
      <image:title>White Golden Designer Brooch 10</image:title>
      <image:caption>White Golden Designer Brooch 10</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/whitegoldendesignerbrooch11</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/245edf38e0fdd600e968ee49f4771b4e.jpg?v=1642157861</image:loc>
      <image:title>White Golden Designer Brooch 11</image:title>
      <image:caption>White Golden Designer Brooch 11</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/whitegoldendesignerbrooch12</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d53191a77d76c9068b161a512e71b4eb.jpg?v=1642157877</image:loc>
      <image:title>White Golden Designer Brooch 12</image:title>
      <image:caption>White Golden Designer Brooch 12</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/whitegoldendesignerbrooch13</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/559243a8390d6a75e1e086aaa6709026.jpg?v=1642157900</image:loc>
      <image:title>White Golden Designer Brooch 13</image:title>
      <image:caption>White Golden Designer Brooch 13</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/goldendesignerbrooch1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/0f9cd2121ecf8e69bb2ab64fcd7f9809.jpg?v=1642157917</image:loc>
      <image:title>Golden Designer Brooch 1</image:title>
      <image:caption>Golden Designer Brooch 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/goldendesignerbrooch2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a9bb0f1fe96e9a63759338408b4e80a4.jpg?v=1642157934</image:loc>
      <image:title>Golden Designer Brooch 2</image:title>
      <image:caption>Golden Designer Brooch 2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/goldendesignerbrooch3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c68f823cf1953233f2cfc187c553f744.jpg?v=1642157950</image:loc>
      <image:title>Golden Designer Brooch 3</image:title>
      <image:caption>Golden Designer Brooch 3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/goldendesignerbrooch4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1cea5bb0f5ee76e405d41f0d3efb0983.jpg?v=1642157969</image:loc>
      <image:title>Golden Designer Brooch 4</image:title>
      <image:caption>Golden Designer Brooch 4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/goldendesignerbrooch5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/851410164331e1ffc5c0743e001ec4bb.jpg?v=1642157980</image:loc>
      <image:title>Golden Designer Brooch 5</image:title>
      <image:caption>Golden Designer Brooch 5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/goldendesignerbrooch6</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/07309838b0591b651d608cd8012c4c1b.jpg?v=1642157994</image:loc>
      <image:title>Golden Designer Brooch 6</image:title>
      <image:caption>Golden Designer Brooch 6</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/goldendesignerbrooch7</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/7b56e553354ec406817d70c170babfc7.jpg?v=1642158018</image:loc>
      <image:title>Golden Designer Brooch 7</image:title>
      <image:caption>Golden Designer Brooch 7</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/geometric-circles-2-hole-wooden-buttons-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-14-16-31-3_product_1_1642158063313.jpg?v=1642158069</image:loc>
      <image:title>Light Yellow Geometric Circles 2 Hole Wooden Buttons</image:title>
      <image:caption>geometric-circles-2-hole-wooden-buttons-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/goldendesignerbrooch8</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/4d1aee409fd9ec48be97bb61771ff2ba.jpg?v=1642158074</image:loc>
      <image:title>Golden Designer Brooch 8</image:title>
      <image:caption>Golden Designer Brooch 8</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silverdesignerbrooch1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/be89b4067f13a86872a13555463fdd56.jpg?v=1642158091</image:loc>
      <image:title>Silver Designer Brooch 1</image:title>
      <image:caption>Silver Designer Brooch 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/goldendesignerbrooch9</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9e4c40eb5216f2c3545d6e6548de6260.jpg?v=1642158107</image:loc>
      <image:title>Golden Designer Brooch 9</image:title>
      <image:caption>Golden Designer Brooch 9</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silverdesignerbrooch2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/61a314030aef55a761517b43bd812372.jpg?v=1642158124</image:loc>
      <image:title>Silver Designer Brooch 2</image:title>
      <image:caption>Silver Designer Brooch 2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/goldendesignerbrooch10</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6a110dc6ac258ffe427ddb3fa5888967.jpg?v=1642158142</image:loc>
      <image:title>Golden Designer Brooch 10</image:title>
      <image:caption>Golden Designer Brooch 10</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/goldendesignerbrooch11</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/15a777ef7133bc8c550be9af1547b8cb.jpg?v=1642158158</image:loc>
      <image:title>Golden Designer Brooch 11</image:title>
      <image:caption>Golden Designer Brooch 11</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/goldendesignerbrooch12</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/def6b739c6e4367362680133d98b3994.jpg?v=1642158174</image:loc>
      <image:title>Golden Designer Brooch 12</image:title>
      <image:caption>Golden Designer Brooch 12</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/floral-2-hole-wooden-buttons-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-14-16-37-52_product_1_1642158472718.jpg?v=1642158479</image:loc>
      <image:title>Light Yellow Floral 2 Hole Wooden Buttons</image:title>
      <image:caption>floral-2-hole-wooden-buttons-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/abstract-2-hole-wooden-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-14-16-38-25_product_1_1642158505220.jpg?v=1642158511</image:loc>
      <image:title>Light Yellow Abstract 2 Hole Wooden Buttons</image:title>
      <image:caption>abstract-2-hole-wooden-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/beige-abstract-self-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-15-12-17-47_product_1_1642229267437.jpg?v=1642229294</image:loc>
      <image:title>Beige Abstract Self Embroidered Chanderi Fabric</image:title>
      <image:caption>beige-abstract-self-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peacock-green-gota-patti-taffeta-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-15-12-24-49_product_1_1642229689637.jpg?v=1642229732</image:loc>
      <image:title>Peacock Green Floral Gota Patti Embroidered Taffeta Silk Fabric</image:title>
      <image:caption>peacock-green-gota-patti-taffeta-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-organza-with-geometric-rose-gold-gotta-patti-work</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-15-12-29-7_product_1_1642229947486.jpg?v=1642229971</image:loc>
      <image:title>White Rose Golden Geometric Gota Patti Embroidered Organza Fabric</image:title>
      <image:caption>white-organza-with-geometric-rose-gold-gotta-patti-work</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-self-patterned-geometric-cotton-fabric-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-15-12-33-56_product_1_1642230236028.jpg?v=1642230257</image:loc>
      <image:title>White Self Patterned Geometric Cotton Fabric</image:title>
      <image:caption>white-self-patterned-geometric-cotton-fabric-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fuschia-pink-georgette-with-gota-patti-work</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-15-12-38-50_product_1_1642230530339.jpg?v=1642230557</image:loc>
      <image:title>Fuchsia Pink Floral Gota Patti Embroidered Georgette Fabric</image:title>
      <image:caption>fuschia-pink-georgette-with-gota-patti-work</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-georgette-with-rose-gold-gotta-patti-embroidery-work</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-15-12-43-33_product_1_1642230813160.jpg?v=1642230839</image:loc>
      <image:title>Black Rose Gold Gota Patti Floral Embroidered Georgette Fabric</image:title>
      <image:caption>black-georgette-with-rose-gold-gotta-patti-embroidery-work</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-golden-weaved-checks-organza</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-15-12-49-0_product_1_1642231140993.jpg?v=1642231163</image:loc>
      <image:title>Green Golden Weaved Checks Organza Fabric</image:title>
      <image:caption>green-golden-weaved-checks-organza</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/beige-gota-patti-patches-4-5-inches</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-15-17-56-7_product_1_1642249567329.jpg?v=1642249572</image:loc>
      <image:title>Beige Gota Patti Patches - 4.5 Inches</image:title>
      <image:caption>beige-gota-patti-patches-4-5-inches</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/magenta-pink-gota-patti-patches-4-5-inches</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-15-17-57-2_product_1_1642249622336.jpg?v=1642249628</image:loc>
      <image:title>Magenta Pink Gota Patti Patches - 4.5 Inches</image:title>
      <image:caption>magenta-pink-gota-patti-patches-4-5-inches</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-gota-patti-patches-4-5-inches</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-15-17-57-36_product_1_1642249656674.jpg?v=1642249662</image:loc>
      <image:title>Yellow Gota Patti Patches - 4.5 Inches</image:title>
      <image:caption>yellow-gota-patti-patches-4-5-inches</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-gota-patti-patches-4-5-inches</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-15-17-58-26_product_1_1642249706257.jpg?v=1642249711</image:loc>
      <image:title>Green Gota Patti Patches - 4.5 Inches</image:title>
      <image:caption>green-gota-patti-patches-4-5-inches</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-checks-gota-work-embroidered-lace</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-15-18-4-28_product_1_1642250068529.jpg?v=1642250074</image:loc>
      <image:title>Green Checks Gota Work Embroidered Lace</image:title>
      <image:caption>green-checks-gota-work-embroidered-lace</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-green-checks-gota-work-embroidered-lace</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-15-18-5-41_product_1_1642250141744.jpg?v=1642250148</image:loc>
      <image:title>Light Green Checks Gota Work Embroidered Lace</image:title>
      <image:caption>light-green-checks-gota-work-embroidered-lace</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/magenta-pink-checks-gota-work-embroidered-lace</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-15-18-6-19_product_1_1642250179095.jpg?v=1642250184</image:loc>
      <image:title>Magenta Pink Checks Gota Work Embroidered Lace</image:title>
      <image:caption>magenta-pink-checks-gota-work-embroidered-lace</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-checks-gota-work-embroidered-lace</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-15-18-6-52_product_1_1642250212296.jpg?v=1642250217</image:loc>
      <image:title>Red Checks Gota Work Embroidered Lace</image:title>
      <image:caption>red-checks-gota-work-embroidered-lace</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-checks-gota-work-embroidered-lace</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-15-18-7-54_product_1_1642250274965.jpg?v=1642250281</image:loc>
      <image:title>Yellow Checks Gota Work Embroidered Lace</image:title>
      <image:caption>yellow-checks-gota-work-embroidered-lace</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-checks-gota-work-embroidered-lace</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-15-18-8-37_product_1_1642250317971.jpg?v=1642250324</image:loc>
      <image:title>Blue Checks Gota Work Embroidered Lace</image:title>
      <image:caption>blue-checks-gota-work-embroidered-lace</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/magenta-pink-designer-gota-work-embroidered-border</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-15-18-47-56_product_1_1642252676106.jpg?v=1642252682</image:loc>
      <image:title>Magenta Pink Designer Gota Work Embroidered Border</image:title>
      <image:caption>magenta-pink-designer-gota-work-embroidered-border</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cotton-flex-solid-plain-fabric-natural</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-17-12-57-4_product_1_1642404424218.jpg?v=1642404427</image:loc>
      <image:title>Beige Natural Plain Flex Cotton Fabric</image:title>
      <image:caption>cotton-flex-solid-plain-fabric-natural</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cotton-flex-solid-plain-fabric-rust-orange</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-17-13-1-4_product_1_1642404664804.jpg?v=1642404668</image:loc>
      <image:title>Rust Orange Plain Flex Cotton Fabric</image:title>
      <image:caption>cotton-flex-solid-plain-fabric-rust-orange</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-designer-gota-work-embroidered-border</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-17-17-40-39_product_1_1642421439786.jpg?v=1642421445</image:loc>
      <image:title>Red Designer Gota Work Embroidered Border</image:title>
      <image:caption>red-designer-gota-work-embroidered-border</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-designer-gota-work-embroidered-border</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-17-17-41-13_product_1_1642421473498.jpg?v=1642421478</image:loc>
      <image:title>Yellow Designer Gota Work Embroidered Border</image:title>
      <image:caption>yellow-designer-gota-work-embroidered-border</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-designer-gota-work-embroidered-border</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-17-17-41-45_product_1_1642421505226.jpg?v=1642421510</image:loc>
      <image:title>Green Gota Work Embroidered Border</image:title>
      <image:caption>green-designer-gota-work-embroidered-border</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-designer-gota-work-embroidered-border</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-17-17-46-29_product_1_1642421789908.jpg?v=1642421795</image:loc>
      <image:title>Multicolour Designer Gota Work Embroidered Border</image:title>
      <image:caption>multicolor-designer-gota-work-embroidered-border</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-golden-weaved-checks-organza</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-18-16-14-7_product_1_1642502647780.jpg?v=1642502660</image:loc>
      <image:title>Yellow golden weaved checks organza</image:title>
      <image:caption>yellow-golden-weaved-checks-organza</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/beige-multicolored-cross-stitch-chanderi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-18-16-17-52_product_1_1642502872041.jpg?v=1642502890</image:loc>
      <image:title>Beige Multicolour Cross Stitch Flowers Embroidered Chanderi Fabric</image:title>
      <image:caption>beige-multicolored-cross-stitch-chanderi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-georgette-with-heavy-rose-gold-gota-patti-embroidery-work</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-18-16-21-56_product_1_1642503116148.jpg?v=1642503139</image:loc>
      <image:title>Black Rose Gold Gota Patti Floral Stripes Embroidered Georgette Fabric</image:title>
      <image:caption>black-georgette-with-heavy-rose-gold-gota-patti-embroidery-work</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/gold-plated-brass-wire-30-gauge-bwire-002-sold-by-pre-roll-of-100-gram</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-19-11-59-7_product_1_1642573747928.jpg?v=1745222743</image:loc>
      <image:title>Golden Plated Brass Wire- 30 Gauge</image:title>
      <image:caption>gold-plated-brass-wire-30-gauge-bwire-002-sold-by-pre-roll-of-100-gram</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/gold-plated-brass-wire-28-gauge-bwire-002-sold-by-pre-roll-of-100-gram</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-19-12-10-43_product_1_1642574443067.jpg?v=1745222746</image:loc>
      <image:title>Golden Plated Brass Wire- 28 Gauge</image:title>
      <image:caption>gold-plated-brass-wire-28-gauge-bwire-002-sold-by-pre-roll-of-100-gram</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-organza-with-rose-gold-gota-patti-embroidery-work</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-19-12-26-38_product_1_1642575398340.jpg?v=1642575425</image:loc>
      <image:title>White Gold Gota Patti Stripes machine Embroidered Organza Fabric</image:title>
      <image:caption>white-organza-with-rose-gold-gota-patti-embroidery-work</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-taffeta-silk-with-golden-sequins-dori-embroidery-work</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-19-12-30-18_product_1_1642575618305.jpg?v=1642575641</image:loc>
      <image:title>Peach Golden Sequins &amp; Dori Floral Motifs Embroidered Taffeta Silk Fabric</image:title>
      <image:caption>peach-taffeta-silk-with-golden-sequins-dori-embroidery-work</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/gold-plated-brass-wire-26-gauge-bwire-003-sold-by-pre-roll-of-100-gram</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-19-12-32-13_product_1_1642575733336.jpg?v=1745222748</image:loc>
      <image:title>Golden Plated Brass Wire- 26 Gauge</image:title>
      <image:caption>gold-plated-brass-wire-26-gauge-bwire-003-sold-by-pre-roll-of-100-gram</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/gold-plated-brass-wire-24-gauge-bwire-004-sold-by-pre-roll-of-100-gram</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-19-13-8-53_product_1_1642577933316.jpg?v=1745222750</image:loc>
      <image:title>Golden Plated Brass Wire- 24 Gauge</image:title>
      <image:caption>gold-plated-brass-wire-24-gauge-bwire-004-sold-by-pre-roll-of-100-gram</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/gold-plated-brass-wire-22-gauge-bwire-005-sold-by-pre-roll-of-100-gram</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-19-13-14-48_product_1_1642578288787.jpg?v=1745222753</image:loc>
      <image:title>Golden Plated Brass Wire- 22 Gauge</image:title>
      <image:caption>gold-plated-brass-wire-22-gauge-bwire-005-sold-by-pre-roll-of-100-gram</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-plated-brass-wire-30-gauge-bwire-009-sold-by-pre-roll-of-100-gram</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-19-15-20-35_product_1_1642585835346.jpg?v=1745224888</image:loc>
      <image:title>Silver Plated Brass Wire- 30 Gauge</image:title>
      <image:caption>silver-plated-brass-wire-30-gauge-bwire-009-sold-by-pre-roll-of-100-gram</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-plated-brass-wire-28-gauge-bwire-010-sold-by-pre-roll-of-100-gram</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-19-15-26-28_product_1_1642586188481.jpg?v=1745224892</image:loc>
      <image:title>Silver Plated Brass Wire- 28 Gauge</image:title>
      <image:caption>silver-plated-brass-wire-28-gauge-bwire-010-sold-by-pre-roll-of-100-gram</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-plated-brass-wire-26-gauge-bwire-011-sold-by-pre-roll-of-100-gram</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-19-15-57-57_product_1_1642588077326.jpg?v=1745224895</image:loc>
      <image:title>Silver Plated Brass Wire- 26 Gauge</image:title>
      <image:caption>silver-plated-brass-wire-26-gauge-bwire-011-sold-by-pre-roll-of-100-gram</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-plated-brass-wire-24-gauge-bwire-012-sold-by-pre-roll-of-100-gram</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-19-17-10-52_product_1_1642592452868.jpg?v=1745224899</image:loc>
      <image:title>Silver Plated Brass Wire- 24 Gauge</image:title>
      <image:caption>silver-plated-brass-wire-24-gauge-bwire-012-sold-by-pre-roll-of-100-gram</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-plated-brass-wire-22-gauge-bwire-013-sold-by-pre-roll-of-100-gram</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-19-17-20-29_product_1_1642593029119.jpg?v=1745224902</image:loc>
      <image:title>Silver Plated Brass Wire- 22 Gauge</image:title>
      <image:caption>silver-plated-brass-wire-22-gauge-bwire-013-sold-by-pre-roll-of-100-gram</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-plated-brass-wire-20-gauge-bwire-014-sold-by-pre-roll-of-100-gram</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-19-17-24-29_product_1_1642593269244.jpg?v=1745224905</image:loc>
      <image:title>Silver Plated Brass Wire- 20 Gauge</image:title>
      <image:caption>silver-plated-brass-wire-20-gauge-bwire-014-sold-by-pre-roll-of-100-gram</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-plated-brass-wire-16-gauge-bwire-016-sold-by-pre-roll-of-100-gram</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-19-17-36-26_product_1_1642593986362.jpg?v=1745224908</image:loc>
      <image:title>Silver Plated Brass Wire- 16 Gauge</image:title>
      <image:caption>silver-plated-brass-wire-16-gauge-bwire-016-sold-by-pre-roll-of-100-gram</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/copper-plated-brass-wire-30-gauge-bwire-017-sold-by-pre-roll-of-100-gram</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-19-17-41-37_product_1_1642594297659.jpg?v=1745225539</image:loc>
      <image:title>Copper Plated Brass Wire- 30 Gauge</image:title>
      <image:caption>copper-plated-brass-wire-30-gauge-bwire-017-sold-by-pre-roll-of-100-gram</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/copper-plated-brass-wire-28-gauge-bwire-018-sold-by-pre-roll-of-100-gram</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-19-17-45-2_product_1_1642594502483.jpg?v=1745225542</image:loc>
      <image:title>Copper Plated Brass Wire- 24 Gauge</image:title>
      <image:caption>copper-plated-brass-wire-28-gauge-bwire-018-sold-by-pre-roll-of-100-gram</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/copper-plated-brass-wire-28-gauge-bwire-018-sold-by-pre-roll-of-100-gram-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-19-17-45-25_product_1_1642594525739.jpg?v=1745225545</image:loc>
      <image:title>Copper Plated Brass Wire- 28 Gauge</image:title>
      <image:caption>copper-plated-brass-wire-28-gauge-bwire-018-sold-by-pre-roll-of-100-gram-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/copper-plated-brass-wire-26-gauge-bwire-019-sold-by-pre-roll-of-100-gram</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-19-17-48-57_product_1_1642594737553.jpg?v=1745225548</image:loc>
      <image:title>Copper Plated Brass Wire- 26 Gauge</image:title>
      <image:caption>copper-plated-brass-wire-26-gauge-bwire-019-sold-by-pre-roll-of-100-gram</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/beige-colour-plain-cotton-two-ply-handloom-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-19-20-35-38_product_3_1642604738122.jpg?v=1671438212</image:loc>
      <image:title>Dark Beige Plain 2 Ply Handloom Cotton Fabric</image:title>
      <image:caption>beige-colour-plain-cotton-two-ply-handloom-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/copper-plated-brass-wire-22-gauge-bwire-021-sold-by-pre-roll-of-100-gram</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-11-17-43_product_1_1642657663855.jpg?v=1745225551</image:loc>
      <image:title>Copper Plated Brass Wire- 20 Gauge</image:title>
      <image:caption>copper-plated-brass-wire-22-gauge-bwire-021-sold-by-pre-roll-of-100-gram</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/copper-plated-brass-wire-22-gauge-bwire-020-sold-by-pre-roll-of-100-gram</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-11-24-22_product_1_1642658062099.jpg?v=1745225554</image:loc>
      <image:title>Copper Plated Brass Wire- 22 Gauge</image:title>
      <image:caption>copper-plated-brass-wire-22-gauge-bwire-020-sold-by-pre-roll-of-100-gram</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-12x16-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-11-32-53_product_1_1642658573641.jpg?v=1642658595</image:loc>
      <image:title>Purple Rondelle Faceted Czech Glass Beads - 12x16 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-12x16-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/copper-plated-brass-wire-18-gauge-bwire-023-sold-by-pre-roll-of-100-gram</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-11-37-32_product_1_1642658852174.jpg?v=1745225558</image:loc>
      <image:title>Copper Plated Brass Wire- 18 Gauge</image:title>
      <image:caption>copper-plated-brass-wire-18-gauge-bwire-023-sold-by-pre-roll-of-100-gram</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-8x10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-11-43-13_product_1_1642659193639.jpg?v=1642659218</image:loc>
      <image:title>Pink Transparent Rondelle Faceted Czech Glass Beads - 8x10 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-8x10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/copper-plated-brass-wire-16-gauge-bwire-024-sold-by-pre-roll-of-100-gram</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-11-52-30_product_1_1642659750901.jpg?v=1745225561</image:loc>
      <image:title>Copper Plated Brass Wire- 25- 30 Gauge</image:title>
      <image:caption>copper-plated-brass-wire-16-gauge-bwire-024-sold-by-pre-roll-of-100-gram</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-11-52-55_product_1_1642659775553.jpg?v=1642659799</image:loc>
      <image:title>Pink Transparent Rondelle Faceted Czech Glass Beads - 10 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-8x10-mm-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-11-57-16_product_1_1642660036852.jpg?v=1642660057</image:loc>
      <image:title>Black Rondelle Faceted Czech Glass Beads - 8x10 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-8x10-mm-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-8-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-12-1-9_product_1_1642660269000.jpg?v=1642660292</image:loc>
      <image:title>Black Rondelle Faceted Czech Glass Beads - 8 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-8-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-12-mm-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-12-4-37_product_1_1642660477960.jpg?v=1642660498</image:loc>
      <image:title>Purple Rondelle Faceted Crystal Czech Glass Beads - 12 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-12-mm-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-4-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-12-7-50_product_1_1642660670449.jpg?v=1642660690</image:loc>
      <image:title>Black Rondelle / Tyre Faceted Crystal Czech Glass Beads - 4 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-4-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-4x6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-12-17-2_product_1_1642661222094.jpg?v=1642661242</image:loc>
      <image:title>Golden Faceted Spherical Czech Glass Beads- 4x6 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-4x6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-velvet-patches-with-embroidered-golden-zari-work</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-12-26-55_product_1_1642661815682.jpg?v=1642661833</image:loc>
      <image:title>Black Embroidered Golden Zari Work Velvet Patch</image:title>
      <image:caption>black-velvet-patches-with-embroidered-golden-zari-work</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-golden-zari-embroidered-patches</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-12-29-40_product_1_1642661980585.jpg?v=1642662000</image:loc>
      <image:title>Green Golden Zari Embroidered Patches</image:title>
      <image:caption>green-golden-zari-embroidered-patches</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-georgette-base-sequins-multicolored-embroidered-patch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-12-41-6_product_1_1642662666365.jpg?v=1642662687</image:loc>
      <image:title>Green Multicolour Georgette Base Sequins Multicolored Embroidered Patch</image:title>
      <image:caption>green-georgette-base-sequins-multicolored-embroidered-patch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-bengal-butta-handloom-cotton</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-12-46-16_product_1_1642662976450.jpg?v=1642662996</image:loc>
      <image:title>Yellow Abstract Bengal Butta Handloom Cotton Fabric</image:title>
      <image:caption>yellow-bengal-butta-handloom-cotton</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/tomato-red-bengal-butta-handloom-cotton</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-12-51-56_product_1_1642663316450.jpg?v=1642663332</image:loc>
      <image:title>Tomato Red Abstract Bengal Butta Handloom Cotton Fabric</image:title>
      <image:caption>tomato-red-bengal-butta-handloom-cotton</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-8x10-mm-3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-14-56-52_product_1_1642670812672.jpg?v=1642670833</image:loc>
      <image:title>Purple Faceted Spherical Czech Glass Beads- 8x10 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-8x10-mm-3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-12x16-mm-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-15-2-14_product_1_1642671134665.jpg?v=1642671155</image:loc>
      <image:title>Black Faceted Spherical Czech Glass Beads- 12x16 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-12x16-mm-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-15-5-31_product_1_1642671331873.jpg?v=1642671352</image:loc>
      <image:title>Light Golden Transparent Bicone Faceted Czech Glass Crystal Beads - 6 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-15-32-10_product_1_1642672930669.jpg?v=1642672949</image:loc>
      <image:title>White Transparent Faceted Spherical Czech Glass Crystal Beads- 10 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-10x14-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-15-38-4_product_1_1642673284553.jpg?v=1642673305</image:loc>
      <image:title>White Transparent Faceted Spherical Czech Glass Crystal Beads- 10x14 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-10x14-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-9x12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-15-43-43_product_1_1642673623650.jpg?v=1642673645</image:loc>
      <image:title>White Transparent Faceted Spherical Czech Glass Crystal Beads- 9x12 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-9x12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-10x13-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-15-50-13_product_1_1642674013426.jpg?v=1642674033</image:loc>
      <image:title>White Drop Crystal Czech Glass Beads - 10x13 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-10x13-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-14x18-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-16-18-8_product_1_1642675688286.jpg?v=1642675709</image:loc>
      <image:title>White Transparent Rondelle Faceted Czech Glass Beads-  14x18 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-14x18-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-6x8-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-16-24-18_product_1_1642676058203.jpg?v=1642676077</image:loc>
      <image:title>White Transparent Rondelle Faceted Spherical Czech Glass Beads- 6x8 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-6x8-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-12x16-mm-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-16-37-4_product_1_1642676824263.jpg?v=1642676843</image:loc>
      <image:title>White Transparent Rondelle Faceted Crystal Czech Glass Beads- 12x16 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-12x16-mm-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-4x6-mm-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-16-55-30_product_1_1642677930515.jpg?v=1642677950</image:loc>
      <image:title>White Transparent Rondelle Faceted Crystal Czech Glass Beads- 4x6 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-4x6-mm-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-6-mm-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-17-1-17_product_1_1642678277810.jpg?v=1642678299</image:loc>
      <image:title>White Transparent Bicone Faceted Crystal Czech Glass Beads- 6 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-6-mm-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-14x18-mm-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-17-5-26_product_1_1642678526002.jpg?v=1642678547</image:loc>
      <image:title>Black Rondelle Faceted Crystal Czech Glass Beads- 14x18 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-14x18-mm-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-6x8-mm-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-17-18-58_product_1_1642679338282.jpg?v=1642679358</image:loc>
      <image:title>Black Rondelle Faceted Crystal Czech Glass Beads- 6x8 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-6x8-mm-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-4x6-mm-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-17-23-42_product_1_1642679622220.jpg?v=1642679641</image:loc>
      <image:title>Black Rondelle Faceted Crystal Czech Glass Beads- 4x6 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-4x6-mm-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-10x14-mm-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-17-30-9_product_1_1642680009200.jpg?v=1642680029</image:loc>
      <image:title>Black Rondelle Faceted Crystal Czech Glass Beads- 10x14 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-10x14-mm-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-12-mm-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-18-15-15_product_1_1642682715233.jpg?v=1642682733</image:loc>
      <image:title>Black Rondelle Faceted Crystal Czech Glass Beads- 12 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-12-mm-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-9x12-mm-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-18-19-48_product_1_1642682988430.jpg?v=1642683008</image:loc>
      <image:title>Black Rondelle Faceted Crystal Czech Glass Beads- 9x12 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-9x12-mm-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-12x16-mm-3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-18-29-11_product_1_1642683551123.jpg?v=1642683571</image:loc>
      <image:title>White Transparent Rondelle Faceted Crystal Czech Glass Beads- 12x16 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-12x16-mm-3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-14x18-mm-3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-18-35-35_product_1_1642683935550.jpg?v=1642683957</image:loc>
      <image:title>Pink Transparent Rondelle Faceted Crystal Czech Glass Beads- 14x18 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-14x18-mm-3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-12-mm-3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-18-40-22_product_1_1642684222731.jpg?v=1642684244</image:loc>
      <image:title>White Transparent Rondelle Faceted Crystal Czech Glass Beads- 12 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-12-mm-3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-8x10-mm-4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-20-18-44-43_product_1_1642684483249.jpg?v=1642684504</image:loc>
      <image:title>Pink Transparent Rondelle Faceted Crystal Czech Glass Beads- 8x10 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-8x10-mm-4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cream-oval-glass-pearl-beads-10-8mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-21-1-47-9_product_1_1642709829454.jpg?v=1642709835</image:loc>
      <image:title>Cream Oval Glass Pearl Beads</image:title>
      <image:caption>cream-oval-glass-pearl-beads-10-8mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cream-tyre-shape-glass-pearl-beads-6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-21-1-54-53_product_1_1642710293539.jpg?v=1748237843</image:loc>
      <image:title>Cream Tyre Glass Pearl Beads- 6 mm</image:title>
      <image:caption>cream-tyre-shape-glass-pearl-beads-6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cream-drop-glass-pearl-beads-8-6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-21-1-57-18_product_1_1642710438149.jpg?v=1748237846</image:loc>
      <image:title>Cream Drop Glass Pearl Beads- 8x6 mm</image:title>
      <image:caption>cream-drop-glass-pearl-beads-8-6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transparent-golden-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-21-2-6-31_product_1_1642710991520.jpg?v=1748237839</image:loc>
      <image:title>Golden Transparent Circular Glass Beads</image:title>
      <image:caption>transparent-golden-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-6x8-mm-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-21-11-8-50_product_1_1642743530709.jpg?v=1642743553</image:loc>
      <image:title>Purple Rondelle Faceted Crystal Czech Glass Beads- 6x8 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-6x8-mm-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-9x12-mm-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-21-11-12-46_product_1_1642743766773.jpg?v=1642743790</image:loc>
      <image:title>Purple Rondelle Faceted Crystal Czech Glass Beads- 9x12 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-9x12-mm-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-9x12-mm-3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-21-11-18-25_product_1_1642744105182.jpg?v=1642744129</image:loc>
      <image:title>Purple Rondelle Faceted Crystal Czech Glass Beads- 9x12 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-9x12-mm-3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-14x18-mm-4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-21-11-32-11_product_1_1642744931044.jpg?v=1642744955</image:loc>
      <image:title>Purple Rondelle Faceted Crystal Czech Glass Beads- 14x18 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-14x18-mm-4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-10x14-mm-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-21-11-35-46_product_1_1642745146771.jpg?v=1642745170</image:loc>
      <image:title>Purple Rondelle Faceted Crystal Czech Glass Beads- 10x14 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-10x14-mm-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-4x6-mm-3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-21-11-40-24_product_1_1642745424849.jpg?v=1642745447</image:loc>
      <image:title>Purple Rondelle Faceted Crystal Czech Glass Beads- 4x6 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-4x6-mm-3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-12x16-mm-4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-21-11-50-9_product_1_1642746009821.jpg?v=1642746032</image:loc>
      <image:title>Purple Rondelle Faceted Crystal Czech Glass Beads- 12x16 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-12x16-mm-4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-14x18-mm-5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-21-11-55-16_product_1_1642746316689.jpg?v=1642746339</image:loc>
      <image:title>Light Pink Transparent Rondelle Faceted Crystal Czech Glass Beads- 14x18 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-14x18-mm-5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-10x14-mm-3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-21-12-18-16_product_1_1642747696865.jpg?v=1642747719</image:loc>
      <image:title>Light Pink Transparent Rondelle Faceted Crystal Czech Glass Beads- 10x14 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-10x14-mm-3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-9x12-mm-4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-21-12-22-12_product_1_1642747932335.jpg?v=1642747955</image:loc>
      <image:title>Light Pink Transparent Rondelle Faceted Crystal Czech Glass Beads- 9x12 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-9x12-mm-4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-12x16-mm-5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-21-12-31-25_product_1_1642748485686.jpg?v=1642748509</image:loc>
      <image:title>Light Golden Rondelle Faceted Crystal Czech Glass Beads- 12x16 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-12x16-mm-5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/rust-red-bengal-butta-handloom-cotton</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-21-12-43-48_product_1_1642749228025.jpg?v=1642749256</image:loc>
      <image:title>Rust Red Abstract Bengal Butta Handloom Cotton Fabric</image:title>
      <image:caption>rust-red-bengal-butta-handloom-cotton</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-beige-tilak-weaved-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-21-12-47-8_product_1_1642749428170.jpg?v=1642749452</image:loc>
      <image:title>Red Beige Geometric Weaved Cotton Fabric</image:title>
      <image:caption>red-beige-tilak-weaved-cotton-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/maroon-self-pattern-geometric-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-21-12-50-55_product_1_1642749655905.jpg?v=1642749677</image:loc>
      <image:title>Maroon Self Geometric Cotton Fabric</image:title>
      <image:caption>maroon-self-pattern-geometric-cotton-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-gold-self-weaved-cotton</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-21-12-58-18_product_1_1642750098246.jpg?v=1642750126</image:loc>
      <image:title>Black Golden Geometric Self Weaved Cotton Fabric</image:title>
      <image:caption>black-gold-self-weaved-cotton</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-14x18-mm-6</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-21-13-25-2_product_1_1642751702403.jpg?v=1642751725</image:loc>
      <image:title>Light Golden Transparent Rondelle Faceted Crystal Czech Glass Beads- 14x18 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-14x18-mm-6</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-12-mm-4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-21-13-29-9_product_1_1642751949335.jpg?v=1642751971</image:loc>
      <image:title>Light Golden Transparent Rondelle Faceted Crystal Czech Glass Beads- 12 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-12-mm-4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-8x10-mm-5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-21-13-33-33_product_1_1642752213085.jpg?v=1642752235</image:loc>
      <image:title>Light Golden Transparent Rondelle Faceted Crystal Czech Glass Beads- 8x10 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-8x10-mm-5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-9x12-mm-5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-21-13-38-9_product_1_1642752489005.jpg?v=1642752513</image:loc>
      <image:title>Light Golden Transparent Rondelle Faceted Crystal Czech Glass Beads- 9x12 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-9x12-mm-5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-6x8-mm-3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-21-13-41-25_product_1_1642752685926.jpg?v=1642752707</image:loc>
      <image:title>Light Golden Transparent Rondelle Faceted Crystal Czech Glass Beads- 6x8 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-6x8-mm-3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/faceted-spherical-glass-beads-8-mm-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-21-13-44-1_product_1_1642752841616.jpg?v=1642752865</image:loc>
      <image:title>Light Golden Transparent Bicone Faceted Crystal Czech Glass Beads- 8 mm</image:title>
      <image:caption>faceted-spherical-glass-beads-8-mm-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/organic-mistyrose-colour-plain-cotton-dt-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-21-15-53-16_product_2_1642760596026.jpg?v=1671438155</image:loc>
      <image:title>Brown Plain Organic Handloom Cotton Fabric</image:title>
      <image:caption>organic-mistyrose-colour-plain-cotton-dt-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/copper-colour-organic-cotton-dt-handloom-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-21-16-21-23_product_3_1642762283123.jpg?v=1671438053</image:loc>
      <image:title>Copper Plain Organic Handloom Cotton Fabric</image:title>
      <image:caption>copper-colour-organic-cotton-dt-handloom-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/onion-pink-bird-cross-stitch-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-22-12-39-33_product_1_1642835373102.jpg?v=1642835399</image:loc>
      <image:title>Onion Pink Flowers Cross Stitch Embroidered Chanderi Fabric</image:title>
      <image:caption>onion-pink-bird-cross-stitch-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fuschia-pink-georgette-with-golden-gotta-patti-work</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-22-12-43-13_product_1_1642835593350.jpg?v=1642835620</image:loc>
      <image:title>Fuschia Pink Golden Gotta Patti Floral Embroidered Georgette Fabric</image:title>
      <image:caption>fuschia-pink-georgette-with-golden-gotta-patti-work</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-bangal-butta-handloom-cotton</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-22-12-46-35_product_1_1642835795875.jpg?v=1642835825</image:loc>
      <image:title>Green Abstract Bangal Butta Handloom Cotton Fabric</image:title>
      <image:caption>green-bangal-butta-handloom-cotton</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dyeable-italian-crepe-with-satin-finish</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-22-12-50-26_product_1_1642836026802.jpg?v=1642836050</image:loc>
      <image:title>White Plain Dyeable Italian Crepe Satin Fabric</image:title>
      <image:caption>dyeable-italian-crepe-with-satin-finish</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/off-white-self-patterned-brasso-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-22-12-55-13_product_1_1642836313409.jpg?v=1642836337</image:loc>
      <image:title>Off White Self Paisleys Cotton Brasso Fabric</image:title>
      <image:caption>off-white-self-patterned-brasso-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/lime-green-chanderi-with-chikankari-sequins-motifs-allover</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-22-13-0-14_product_1_1642836614397.jpg?v=1642836664</image:loc>
      <image:title>Lime Green White Floral Sequins Floral Motifs Chikankari Embroidered Chanderi Fabric</image:title>
      <image:caption>lime-green-chanderi-with-chikankari-sequins-motifs-allover</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-plain-tissue-organza</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-22-13-4-10_product_1_1642836850258.jpg?v=1642836875</image:loc>
      <image:title>Golden Plain Tissue Organza Fabric</image:title>
      <image:caption>golden-plain-tissue-organza</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/mint-green-chanderi-with-multicolored-thread-zari-motifs</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-22-13-9-6_product_1_1642837146589.jpg?v=1642837185</image:loc>
      <image:title>Mint Green Multicolour Thread &amp; Zari Floral Motifs Embroidered Chanderi Fabric</image:title>
      <image:caption>mint-green-chanderi-with-multicolored-thread-zari-motifs</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-golden-dual-shaded-chanderi-with-multicolored-thread-zari-motifs</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-22-13-14-21_product_1_1642837461983.jpg?v=1642837498</image:loc>
      <image:title>Green Golden Dual Shaded Multicolour Thread Zari Floral Motifs Chanderi Fabric</image:title>
      <image:caption>green-golden-dual-shaded-chanderi-with-multicolored-thread-zari-motifs</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/purple-blue-textured-premium-italian-linen</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-23-12-25-47_product_1_1642920947460.jpg?v=1766736123</image:loc>
      <image:title>Purple Blue Plain Textured Premium Linen Fabric</image:title>
      <image:caption>purple-blue-textured-premium-italian-linen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/mint-green-plain-italian-premium-linen</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-23-12-29-51_product_1_1642921191793.jpg?v=1759057780</image:loc>
      <image:title>Mint Green Plain Premium Linen Fabric</image:title>
      <image:caption>mint-green-plain-italian-premium-linen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/baby-pink-premium-italian-linen-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-23-12-38-47_product_1_1642921727115.jpg?v=1642921737</image:loc>
      <image:title>Baby Pink Plain Premium Linen Fabric</image:title>
      <image:caption>baby-pink-premium-italian-linen-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/aqua-blue-embroidered-chanderi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-23-12-44-39_product_1_1642922079970.jpg?v=1774246170</image:loc>
      <image:title>Aqua Blue Pink Flowers Embroidered Chanderi Fabric</image:title>
      <image:caption>aqua-blue-embroidered-chanderi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/maroon-self-weaved-plain-brocade-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-24-16-31-58_product_1_1643022118418.jpg?v=1643022149</image:loc>
      <image:title>Maroon Self Weaved Plain Brocade Fabric</image:title>
      <image:caption>maroon-self-weaved-plain-brocade-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/bottle-green-geometric-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-24-16-35-39_product_1_1643022339168.jpg?v=1643022352</image:loc>
      <image:title>Bottle Green Abstract Cotton Fabric</image:title>
      <image:caption>bottle-green-geometric-cotton-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-silver-self-weaved-dots-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-24-16-39-5_product_1_1643022545475.jpg?v=1643022563</image:loc>
      <image:title>Yellow Silver Self Weaved Dots Cotton Fabric</image:title>
      <image:caption>yellow-silver-self-weaved-dots-cotton-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/olive-green-georgette-with-kashmiri-work-buttas</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-24-16-43-21_product_1_1643022801943.jpg?v=1643022817</image:loc>
      <image:title>Beige Pink Floral Motifs Kashmiri Work Embroidered Georgette Fabric</image:title>
      <image:caption>olive-green-georgette-with-kashmiri-work-buttas</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/beige-multicolored-embroidered-organza-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-24-16-47-36_product_1_1643023056292.jpg?v=1643023073</image:loc>
      <image:title>Beige Multicolour Floral Embroidered Organza Fabric</image:title>
      <image:caption>beige-multicolored-embroidered-organza-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/bright-orange-bengal-butta-handloom-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-25-12-44-33_product_1_1643094873998.jpg?v=1643094889</image:loc>
      <image:title>Bright Orange Abstract Bengal Butta Handloom Cotton Fabric</image:title>
      <image:caption>bright-orange-bengal-butta-handloom-cotton-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-pink-golden-weaved-checks-organza-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-25-12-50-10_product_1_1643095210360.jpg?v=1643095226</image:loc>
      <image:title>Peach Pink Golden Weaved Checks Organza Fabric</image:title>
      <image:caption>peach-pink-golden-weaved-checks-organza-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-dual-shaded-soft-taffeta-silk-with-golden-dori-motifs-allover</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-25-12-55-42_product_1_1643095542947.jpg?v=1643095557</image:loc>
      <image:title>Blue Dual Shaded Golden Dori Floral Motifs Embroidered Taffeta Silk Fabric</image:title>
      <image:caption>blue-dual-shaded-soft-taffeta-silk-with-golden-dori-motifs-allover</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-chanderi-with-multicolored-embroidered-motifs</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-25-13-35-31_product_1_1643097931832.jpg?v=1643097947</image:loc>
      <image:title>Yellow Multicolour Flowers Embroidered Chanderi Fabric</image:title>
      <image:caption>yellow-chanderi-with-multicolored-embroidered-motifs</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/bright-pink-georgette-with-golden-gota-patti-embroidery</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-26-12-30-8_product_1_1643180408657.jpg?v=1643180435</image:loc>
      <image:title>Bright Pink Golden Gota Patti Flowers Embroidered Georgette Fabric</image:title>
      <image:caption>bright-pink-georgette-with-golden-gota-patti-embroidery</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-georgette-with-embroidered-golden-gota-patti</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-26-12-39-17_product_1_1643180957626.jpg?v=1643180996</image:loc>
      <image:title>Pink Golden Gota Patti Geometric Embroidered Georgette Fabric</image:title>
      <image:caption>pink-georgette-with-embroidered-golden-gota-patti</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/olive-green-embroidered-kashmiri-georgette</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-26-12-47-39_product_1_1643181459969.jpg?v=1643181480</image:loc>
      <image:title>Olive Green Pink Flowers Kashmiri Embroidered Georgette Fabric</image:title>
      <image:caption>olive-green-embroidered-kashmiri-georgette</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-chanderi-silk-with-kashmiri-embroidered-motifs-allover</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-12-25-43_product_3_1643266543263.jpg?v=1705661325</image:loc>
      <image:title>White Red Paisleys Kashmiri Embroidered Motifs Chanderi Silk Fabric</image:title>
      <image:caption>white-chanderi-silk-with-kashmiri-embroidered-motifs-allover</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-tilak-weaved-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-12-29-25_product_1_1643266765217.jpg?v=1643266784</image:loc>
      <image:title>White Geometric Weaved Cotton Fabric</image:title>
      <image:caption>white-tilak-weaved-cotton-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dull-golden-color-round-shape-metal-sequins</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-12-31-49_product_1_1643266909357.jpg?v=1643266913</image:loc>
      <image:title>Dull Golden Round Metal Sequins- 2 cm</image:title>
      <image:caption>dull-golden-color-round-shape-metal-sequins</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dull-golden-color-round-shape-metal-sequins-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-12-37-29_product_1_1643267249094.jpg?v=1643267252</image:loc>
      <image:title>Dull Golden Round Metal Sequins- 7 mm</image:title>
      <image:caption>dull-golden-color-round-shape-metal-sequins-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dull-golden-color-katori-shape-metal-sequins</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-12-47-55_product_1_1643267875118.jpg?v=1643267879</image:loc>
      <image:title>Dull Golden Bowl Metal Sequins- 4 mm</image:title>
      <image:caption>dull-golden-color-katori-shape-metal-sequins</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-chanderi-with-white-lakhnawi-sequins-motifs-allover</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-12-50-15_product_1_1643268015450.jpg?v=1643268036</image:loc>
      <image:title>Yellow White Flowers Lakhnawi Sequins Embroidered Chanderi Fabric</image:title>
      <image:caption>yellow-chanderi-with-white-lakhnawi-sequins-motifs-allover</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-chanderi-with-white-lakhnawi-sequins-motifs</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-12-54-3_product_1_1643268243291.jpg?v=1643268262</image:loc>
      <image:title>Yellow White Floral Motifs Lakhnawi Sequins Embroidered Chanderi Fabric</image:title>
      <image:caption>yellow-chanderi-with-white-lakhnawi-sequins-motifs</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-multicolored-embroidered-cross-stitch-chanderi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-12-59-27_product_1_1643268567563.jpg?v=1643268610</image:loc>
      <image:title>Peach Multicolour Flowers Embroidered Chanderi Fabric</image:title>
      <image:caption>peach-multicolored-embroidered-cross-stitch-chanderi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/antique-color-design-6-holes-metal-sequins</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-13-48-24_product_1_1643271504528.jpg?v=1643271508</image:loc>
      <image:title>Antique Golden Rectangular 6 Holes Metal Sequins- 3x0.4 cm</image:title>
      <image:caption>antique-color-design-6-holes-metal-sequins</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-flat-circular-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-16-38-14_product_1_1643281694866.jpg?v=1749808643</image:loc>
      <image:title>Peach Flat Circular Crystal Beads</image:title>
      <image:caption>peach-flat-circular-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/bronze-flat-circular-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-16-39-20_product_1_1643281760384.jpg?v=1749808641</image:loc>
      <image:title>Bronze Flat Circular Crystal Beads</image:title>
      <image:caption>bronze-flat-circular-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/purple-flat-circular-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-16-41-7_product_1_1643281867514.jpg?v=1749808640</image:loc>
      <image:title>White Rainbow Flat Circular Crystal Beads</image:title>
      <image:caption>purple-flat-circular-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-multicolor-flat-circular-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-16-45-31_product_1_1643282131661.jpg?v=1749808638</image:loc>
      <image:title>Blue Multicolor Flat Circular Crystal Beads</image:title>
      <image:caption>blue-multicolor-flat-circular-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-flat-circular-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-16-46-33_product_1_1643282193795.jpg?v=1749808636</image:loc>
      <image:title>Black Flat Circular Crystal Beads</image:title>
      <image:caption>black-flat-circular-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-dual-shade-drop-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-17-17-3_product_1_1643284023178.jpg?v=1752825200</image:loc>
      <image:title>Peach Dual Shade Drop Crystal Beads</image:title>
      <image:caption>peach-dual-shade-drop-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-blue-dual-shade-drop-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-17-18-51_product_1_1643284131723.jpg?v=1752825198</image:loc>
      <image:title>Light Blue Dual Shade Drop Crystal Beads</image:title>
      <image:caption>light-blue-dual-shade-drop-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/purple-dual-shade-drop-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-17-19-28_product_1_1643284168355.jpg?v=1752825197</image:loc>
      <image:title>Purple Dual Shade Drop Crystal Beads</image:title>
      <image:caption>purple-dual-shade-drop-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-green-dual-shade-drop-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-17-20-6_product_1_1643284206340.jpg?v=1752825196</image:loc>
      <image:title>Dark Green Dual Shade Drop Crystal Beads</image:title>
      <image:caption>dark-green-dual-shade-drop-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/purple-transparent-dual-shade-drop-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-17-20-38_product_1_1643284238596.jpg?v=1752825195</image:loc>
      <image:title>Purple Transparent Dual Shade Drop Crystal Beads</image:title>
      <image:caption>purple-transparent-dual-shade-drop-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-white-drop-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-17-21-17_product_1_1643284277329.jpg?v=1752825194</image:loc>
      <image:title>Peach White Dual Shade Drop Crystal Beads</image:title>
      <image:caption>peach-white-drop-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-pink-dual-shade-drop-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-17-22-1_product_1_1643284321903.jpg?v=1752825192</image:loc>
      <image:title>Golden Pink Dual Shade Drop Crystal Beads</image:title>
      <image:caption>golden-pink-dual-shade-drop-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/brown-rivoli-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-17-38-8_product_1_1643285288914.jpg?v=1749808635</image:loc>
      <image:title>Brown Rivoli Crystal Beads</image:title>
      <image:caption>brown-rivoli-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-rivoli-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-17-38-41_product_1_1643285321810.jpg?v=1749808634</image:loc>
      <image:title>White Rivoli Crystal Beads</image:title>
      <image:caption>white-rivoli-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/jet-black-rivoli-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-17-40-19_product_1_1643285419085.jpg?v=1749808632</image:loc>
      <image:title>Jet Black Rivoli Crystal Beads</image:title>
      <image:caption>jet-black-rivoli-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-rivoli-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-17-41-13_product_1_1643285473684.jpg?v=1749808630</image:loc>
      <image:title>Peach Rivoli Crystal Beads</image:title>
      <image:caption>peach-rivoli-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-transparent-rivoli-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-17-43-12_product_1_1643285592935.jpg?v=1749808629</image:loc>
      <image:title>Silver Transparent Rivoli Crystal Beads</image:title>
      <image:caption>silver-transparent-rivoli-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transparent-rainbow-conical-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-18-11-2_product_1_1643287262332.jpg?v=1643287270</image:loc>
      <image:title>White Transparent Rainbow Conical Crystal Beads</image:title>
      <image:caption>transparent-rainbow-conical-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-conical-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-18-14-33_product_1_1643287473604.jpg?v=1643287481</image:loc>
      <image:title>Peach Transparent Conical Crystal Beads</image:title>
      <image:caption>peach-conical-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-multicolor-conical-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-18-15-9_product_1_1643287509570.jpg?v=1643287517</image:loc>
      <image:title>Golden Rainbow Conical Crystal Beads</image:title>
      <image:caption>pink-multicolor-conical-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transparent-conical-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-18-15-43_product_1_1643287543125.jpg?v=1643287550</image:loc>
      <image:title>White Transparent Conical Crystal Beads</image:title>
      <image:caption>transparent-conical-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-black-conical-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-18-16-17_product_1_1643287577326.jpg?v=1643287585</image:loc>
      <image:title>Blue Black Conical Crystal Beads</image:title>
      <image:caption>blue-black-conical-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transparent-multicolor-conical-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-18-16-56_product_1_1643287616205.jpg?v=1643287623</image:loc>
      <image:title>White Transparent Rainbow Conical Crystal Beads</image:title>
      <image:caption>transparent-multicolor-conical-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-diamond-shadow-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-18-20-1_product_1_1643287801720.jpg?v=1749808627</image:loc>
      <image:title>White Diamond Flat Faceted Shadow Crystal Beads</image:title>
      <image:caption>black-diamond-shadow-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-golden-shadow-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-18-21-5_product_1_1643287865862.jpg?v=1749808626</image:loc>
      <image:title>Peach Golden Shadow Flat Faceted Crystal Beads</image:title>
      <image:caption>peach-golden-shadow-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-cubic-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-18-52-14_product_1_1643289734867.jpg?v=1737796773</image:loc>
      <image:title>Pastel Pink Tyre Crystal Beads</image:title>
      <image:caption>white-cubic-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-black-cubic-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-18-52-56_product_1_1643289776470.jpg?v=1737796775</image:loc>
      <image:title>Blue Black Cubic Crystal Beads</image:title>
      <image:caption>blue-black-cubic-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transparent-rainbow-cubic-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-18-53-32_product_1_1643289812227.jpg?v=1737796776</image:loc>
      <image:title>Transparent Rainbow Cubic Crystal Beads</image:title>
      <image:caption>transparent-rainbow-cubic-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-transparent-cubic-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-18-54-2_product_1_1643289842166.jpg?v=1737796778</image:loc>
      <image:title>Multicolour Transparent Cubic Crystal Beads</image:title>
      <image:caption>multicolor-transparent-cubic-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-transparent-cubic-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-18-54-30_product_1_1643289870579.jpg?v=1737796779</image:loc>
      <image:title>Light Pink Transparent Cubic Crystal Beads</image:title>
      <image:caption>white-transparent-cubic-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-transparent-cubic-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-18-55-2_product_1_1643289902527.jpg?v=1737796781</image:loc>
      <image:title>Transparent White Cubic Crystal Beads</image:title>
      <image:caption>black-transparent-cubic-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-cubic-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-18-55-37_product_1_1643289937225.jpg?v=1737796783</image:loc>
      <image:title>Black Cubic Crystal Beads</image:title>
      <image:caption>black-cubic-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-transparent-cubic-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-18-56-9_product_1_1643289969498.jpg?v=1737796784</image:loc>
      <image:title>Blue Transparent Cubic Crystal Beads</image:title>
      <image:caption>blue-transparent-cubic-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/brown-transparent-cubic-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-18-56-44_product_1_1643290004490.jpg?v=1737796785</image:loc>
      <image:title>White Transparent Cubic Crystal Beads</image:title>
      <image:caption>brown-transparent-cubic-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transparent-conical-crystal-beads-8x12mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-19-7-21_product_1_1643290641808.jpg?v=1643290650</image:loc>
      <image:title>Transparent Conical Crystal Beads- 8x12mm</image:title>
      <image:caption>transparent-conical-crystal-beads-8x12mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-transparent-conical-crystal-beads-8x12mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-19-8-44_product_1_1643290724350.jpg?v=1643290733</image:loc>
      <image:title>Black Transparent Conical Crystal Beads- 8x12mm</image:title>
      <image:caption>black-transparent-conical-crystal-beads-8x12mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-conical-crystal-beads-8x12mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-27-19-9-18_product_1_1643290758481.jpg?v=1643290768</image:loc>
      <image:title>Baby Pink Conical Crystal Beads- 8x12mm</image:title>
      <image:caption>peach-conical-crystal-beads-8x12mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/teal-blue-georgette-with-golden-gota-patti-work</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-28-13-7-53_product_1_1643355473209.jpg?v=1643355498</image:loc>
      <image:title>Teal Blue Golden Gota Patti Flowers Embroidered Georgette Fabric</image:title>
      <image:caption>teal-blue-georgette-with-golden-gota-patti-work</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-orange-multicoloured-motifs-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-28-13-16-35_product_1_1643355995785.jpg?v=1643356017</image:loc>
      <image:title>Light Orange Green Multicolour Floral Motifs Embroidered Chanderi Fabric</image:title>
      <image:caption>light-orange-multicoloured-motifs-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-chanderi-with-multicolored-embroidered-motifs</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-28-13-20-55_product_1_1643356255615.jpg?v=1643356281</image:loc>
      <image:title>White Green Multicolour Floral Motifs Embroidered Chanderi Fabric</image:title>
      <image:caption>white-chanderi-with-multicolored-embroidered-motifs</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transparent-rainbow-spherical-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-28-16-35-28_product_1_1643367928854.jpg?v=1750929081</image:loc>
      <image:title>White Transparent Rainbow Spherical Crystal Beads</image:title>
      <image:caption>transparent-rainbow-spherical-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-spherical-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-28-16-37-25_product_1_1643368045004.jpg?v=1750929080</image:loc>
      <image:title>White Spherical Crystal Beads</image:title>
      <image:caption>white-spherical-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-black-spherical-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-28-16-38-27_product_1_1643368107564.jpg?v=1750929078</image:loc>
      <image:title>Blue Black Spherical Crystal Beads</image:title>
      <image:caption>blue-black-spherical-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-transparent-spherical-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-28-16-38-56_product_1_1643368136073.jpg?v=1749808624</image:loc>
      <image:title>Black Transparent Spherical Crystal Beads</image:title>
      <image:caption>black-transparent-spherical-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transparent-spherical-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-28-16-40-59_product_1_1643368259458.jpg?v=1750929077</image:loc>
      <image:title>White Transparent Spherical Crystal Beads</image:title>
      <image:caption>transparent-spherical-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-spherical-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-28-16-41-46_product_1_1643368306414.jpg?v=1750929076</image:loc>
      <image:title>Peach Spherical Crystal Beads</image:title>
      <image:caption>peach-spherical-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transparent-flat-rectangular-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-28-17-1-20_product_1_1643369480735.jpg?v=1750746648</image:loc>
      <image:title>White Transparent Flat Rectangular Crystal Beads</image:title>
      <image:caption>transparent-flat-rectangular-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-blue-flat-rectangular-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-28-17-2-6_product_1_1643369526592.jpg?v=1750746647</image:loc>
      <image:title>Dark Blue Flat Rectangular Crystal Beads</image:title>
      <image:caption>dark-blue-flat-rectangular-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-flat-rectangular-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-28-17-3-34_product_1_1643369614207.jpg?v=1750746645</image:loc>
      <image:title>White Flat Rectangular Crystal Beads</image:title>
      <image:caption>white-flat-rectangular-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-white-flat-rectangular-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-28-17-4-4_product_1_1643369644076.jpg?v=1750746644</image:loc>
      <image:title>Peach &amp; White Flat Rectangular Crystal Beads</image:title>
      <image:caption>peach-white-flat-rectangular-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/rust-orange-flat-rectangular-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-28-17-4-40_product_1_1643369680968.jpg?v=1750746642</image:loc>
      <image:title>Rust Orange Flat Rectangular Crystal Beads</image:title>
      <image:caption>rust-orange-flat-rectangular-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-silver-flat-rectangular-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-28-17-5-10_product_1_1643369710414.jpg?v=1750746641</image:loc>
      <image:title>Golden Silver Flat Rectangular Crystal Beads</image:title>
      <image:caption>golden-silver-flat-rectangular-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-multicolor-flat-rectangular-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-28-17-5-44_product_1_1643369744257.jpg?v=1750746639</image:loc>
      <image:title>Red Multicolor Flat Rectangular Crystal Beads</image:title>
      <image:caption>red-multicolor-flat-rectangular-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-multicolor-flat-rectangular-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-28-17-6-53_product_1_1643369813082.jpg?v=1750746638</image:loc>
      <image:title>Red Multicolor Flat Rectangular Crystal Beads</image:title>
      <image:caption>golden-multicolor-flat-rectangular-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transparent-conical-crystal-beads-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-28-17-10-5_product_1_1643370005030.jpg?v=1752825191</image:loc>
      <image:title>White Transparent Faceted Conical Crystal Beads</image:title>
      <image:caption>transparent-conical-crystal-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/rainbow-faceted-drop-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-28-17-19-38_product_1_1643370578190.jpg?v=1752825190</image:loc>
      <image:title>White Rainbow Faceted Drop Crystal Beads</image:title>
      <image:caption>rainbow-faceted-drop-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-faceted-drop-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-28-17-20-11_product_1_1643370611038.jpg?v=1752825189</image:loc>
      <image:title>White Faceted Drop Crystal Beads</image:title>
      <image:caption>white-faceted-drop-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/smoke-gray-conical-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-28-17-20-51_product_1_1643370651277.jpg?v=1752825187</image:loc>
      <image:title>Smoke Gray Oval Crystal Beads</image:title>
      <image:caption>smoke-gray-conical-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-metallic-conical-crystal-beads-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-28-17-21-28_product_1_1643370688398.jpg?v=1752825186</image:loc>
      <image:title>Golden Metallic Oval Crystal Beads</image:title>
      <image:caption>golden-metallic-conical-crystal-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transparent-faceted-rivoli-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-28-17-25-14_product_1_1643370914663.jpg?v=1749808623</image:loc>
      <image:title>White Transparent Faceted Rivoli Crystal Beads</image:title>
      <image:caption>transparent-faceted-rivoli-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-faceted-rivoli-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-28-17-25-49_product_1_1643370949676.jpg?v=1749808621</image:loc>
      <image:title>Black Faceted Rivoli Crystal Beads</image:title>
      <image:caption>black-faceted-rivoli-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/rainbow-faceted-conical-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-28-17-28-10_product_1_1643371090180.jpg?v=1752825185</image:loc>
      <image:title>Pink Rainbow Faceted Conical Crystal Beads</image:title>
      <image:caption>rainbow-faceted-conical-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transparent-faceted-conical-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-28-17-29-10_product_1_1643371150793.jpg?v=1752825184</image:loc>
      <image:title>White Transparent Faceted Oval Crystal Beads</image:title>
      <image:caption>transparent-faceted-conical-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-faceted-conical-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-28-17-31-20_product_1_1643371280862.jpg?v=1752825183</image:loc>
      <image:title>Peach Faceted Oval Crystal Beads</image:title>
      <image:caption>peach-faceted-conical-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/mint-green-geometric-embroidered-chanderi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-29-10-42-44_product_1_1643433164487.jpg?v=1643433193</image:loc>
      <image:title>Mint Green Geometric Sequins Embroidered Chanderi Fabric</image:title>
      <image:caption>mint-green-geometric-embroidered-chanderi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/mint-green-chanderi-with-rose-gold-sequins-motifs-allover</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-29-10-47-11_product_1_1643433431934.jpg?v=1643433538</image:loc>
      <image:title>Mint Green Rose Gold Sequins Floral Motifs Embroidered Chanderi Fabric</image:title>
      <image:caption>mint-green-chanderi-with-rose-gold-sequins-motifs-allover</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-blue-cotton-with-silver-self-weaved-dots</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-30-13-49-10_product_1_1643530750884.jpg?v=1643530773</image:loc>
      <image:title>Light Blue Silver Self Weaved Dots Cotton Fabric</image:title>
      <image:caption>light-blue-cotton-with-silver-self-weaved-dots</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/beige-heavy-embroidered-mirror-work-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-30-14-0-15_product_1_1643531415647.jpg?v=1643531453</image:loc>
      <image:title>Beige Multicolour Flowers Mirror Work Embroidered Chanderi Fabric</image:title>
      <image:caption>beige-heavy-embroidered-mirror-work-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicoloured-mirror-thread-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-31-12-13-26_product_1_1643611406108.jpg?v=1674477263</image:loc>
      <image:title>Gray Floral Thread and Faux Mirror Embroidered Chanderi Fabric</image:title>
      <image:caption>multicoloured-mirror-thread-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/sky-blue-sequins-embroidered-chanderi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-31-12-19-33_product_1_1643611773624.jpg?v=1643611804</image:loc>
      <image:title>Sky Blue Sequins Flowers Embroidered Chanderi Fabric</image:title>
      <image:caption>sky-blue-sequins-embroidered-chanderi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-chanderi-with-sequinned-embroidered-motifs-allover</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-31-12-26-30_product_1_1643612190199.jpg?v=1643612202</image:loc>
      <image:title>Yellow Multicolour Sequins Geometric Motifs Embroidered Chanderi Fabric</image:title>
      <image:caption>yellow-chanderi-with-sequinned-embroidered-motifs-allover</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-kantha-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-31-12-30-37_product_1_1643612437778.jpg?v=1643612476</image:loc>
      <image:title>White Multicolour Floral Kantha Embroidered Chanderi Fabric</image:title>
      <image:caption>white-kantha-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-conical-drop-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-31-17-33-36_product_1_1643630616188.jpg?v=1643630621</image:loc>
      <image:title>Peach Conical Drop Crystal Beads</image:title>
      <image:caption>peach-conical-drop-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-conical-drop-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-31-18-24-33_product_1_1643633673724.jpg?v=1643633678</image:loc>
      <image:title>White Conical Drop Crystal Beads</image:title>
      <image:caption>white-conical-drop-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-black-conical-drop-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-31-18-25-5_product_1_1643633705104.jpg?v=1643633710</image:loc>
      <image:title>Blue Black Conical Drop Crystal Beads</image:title>
      <image:caption>blue-black-conical-drop-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transparent-rainbow-conical-drop-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-31-18-25-35_product_1_1643633735983.jpg?v=1643633740</image:loc>
      <image:title>White Transparent Rainbow Conical Drop Crystal Beads</image:title>
      <image:caption>transparent-rainbow-conical-drop-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/gray-transparent-conical-drop-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-31-18-26-19_product_1_1643633779723.jpg?v=1643633785</image:loc>
      <image:title>Gray Transparent Conical Drop Crystal Beads</image:title>
      <image:caption>gray-transparent-conical-drop-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-conical-drop-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-31-18-26-52_product_1_1643633812900.jpg?v=1643633818</image:loc>
      <image:title>Multicolor Conical Drop Crystal Beads</image:title>
      <image:caption>multicolor-conical-drop-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-transparent-conical-drop-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-31-18-28-30_product_1_1643633910959.jpg?v=1643633916</image:loc>
      <image:title>Silver Transparent Conical Drop Crystal Beads</image:title>
      <image:caption>silver-transparent-conical-drop-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/rose-gold-drum-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-31-18-51-35_product_1_1643635295221.jpg?v=1749127524</image:loc>
      <image:title>Rose Gold Drum Crystal Beads</image:title>
      <image:caption>rose-gold-drum-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-black-drum-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-31-18-52-2_product_1_1643635322503.jpg?v=1749127526</image:loc>
      <image:title>Blue Black Drum Crystal Beads</image:title>
      <image:caption>blue-black-drum-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/gray-drum-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-31-18-52-36_product_1_1643635356258.jpg?v=1749127527</image:loc>
      <image:title>Gray Drum Crystal Beads</image:title>
      <image:caption>gray-drum-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-drum-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-31-18-53-18_product_1_1643635398115.jpg?v=1749127529</image:loc>
      <image:title>Black Drum Crystal Beads</image:title>
      <image:caption>black-drum-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/rainbow-drum-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-31-18-53-45_product_1_1643635425446.jpg?v=1749127531</image:loc>
      <image:title>Silver Rainbow Drum Crystal Beads</image:title>
      <image:caption>rainbow-drum-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-colour-broach-with-bow-design</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-31-20-6-32_product_1_1643639792800.jpg?v=1643639796</image:loc>
      <image:title>Red Bow Designer Brooch</image:title>
      <image:caption>red-colour-broach-with-bow-design</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-black-rondelle-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-31-20-19-48_product_1_1643640588194.jpg?v=1643640594</image:loc>
      <image:title>Blue Black Rondelle Crystal Beads</image:title>
      <image:caption>blue-black-rondelle-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transparent-rondelle-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-31-20-20-22_product_1_1643640622359.jpg?v=1643640627</image:loc>
      <image:title>White Transparent Rondelle Crystal Beads</image:title>
      <image:caption>transparent-rondelle-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-rondelle-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-31-20-20-52_product_1_1643640652097.jpg?v=1643640657</image:loc>
      <image:title>Multicolour Rondelle Crystal Beads</image:title>
      <image:caption>multicolor-rondelle-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-rondelle-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-31-20-21-22_product_1_1643640682061.jpg?v=1643640687</image:loc>
      <image:title>Peach Rondelle Crystal Beads</image:title>
      <image:caption>peach-rondelle-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/smokey-gray-rondelle-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-31-20-22-9_product_1_1643640729605.jpg?v=1643640734</image:loc>
      <image:title>Smokey Gray Rondelle Crystal Beads</image:title>
      <image:caption>smokey-gray-rondelle-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-multicolor-rondelle-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-31-20-22-57_product_1_1643640777759.jpg?v=1643640782</image:loc>
      <image:title>Pink Multicolor Rondelle Crystal Beads</image:title>
      <image:caption>pink-multicolor-rondelle-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-rondelle-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-31-20-23-26_product_1_1643640806324.jpg?v=1643640811</image:loc>
      <image:title>Black Rondelle Crystal Beads</image:title>
      <image:caption>black-rondelle-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/bronze-rondelle-crystal-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-31-20-23-57_product_1_1643640837384.jpg?v=1643640842</image:loc>
      <image:title>Bronze Rondelle Crystal Beads</image:title>
      <image:caption>bronze-rondelle-crystal-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/precut-2-5-metre-cream-maroon-leaf-polyester-jacquard-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-1-18-14-19_product_1_1643719459525.jpg?v=1643719471</image:loc>
      <image:title>Precut 2.5 Metre Cream Maroon Leaves Polyester Jacquard Fabric</image:title>
      <image:caption>precut-2-5-metre-cream-maroon-leaf-polyester-jacquard-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-fur-patterm-broach-for-garments-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-1-19-9-13_product_1_1643722753960.jpg?v=1643722758</image:loc>
      <image:title>Red Faux Fur Designer Brooches</image:title>
      <image:caption>red-fur-patterm-broach-for-garments-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/magenta-pink-drop-plastic-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-1-19-51-4_product_1_1643725264008.jpg?v=1643725270</image:loc>
      <image:title>Magenta Pink Drop Plastic Beads</image:title>
      <image:caption>magenta-pink-drop-plastic-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-yellow-plastic-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-1-19-57-57_product_1_1643725677936.jpg?v=1643725686</image:loc>
      <image:title>Yellow Golden Uneven Plastic Beads</image:title>
      <image:caption>golden-yellow-plastic-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-golden-color-katori-shape-plastic-sequins-seq0103</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-2-13-43-29_product_1_1643789609423.jpg?v=1643789615</image:loc>
      <image:title>Light Golden Bowl Plastic Sequins</image:title>
      <image:caption>light-golden-color-katori-shape-plastic-sequins-seq0103</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/medium-golden-color-katori-shape-plastic-sequins-seq0104</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-2-13-51-6_product_1_1643790066243.jpg?v=1643790071</image:loc>
      <image:title>Light Golden Bowl Plastic Sequins</image:title>
      <image:caption>medium-golden-color-katori-shape-plastic-sequins-seq0104</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-color-katori-shape-plastic-sequins-seq0105</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-2-13-52-50_product_1_1643790170641.jpg?v=1643790176</image:loc>
      <image:title>Deep Silver Bowl Plastic Sequins</image:title>
      <image:caption>silver-color-katori-shape-plastic-sequins-seq0105</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-mr-color-katori-shape-plastic-sequins-seq0106</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-2-13-59-40_product_1_1643790580006.jpg?v=1643790585</image:loc>
      <image:title>Silver Bowl Plastic Sequins</image:title>
      <image:caption>silver-mr-color-katori-shape-plastic-sequins-seq0106</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dull-golden-color-katori-shape-mm-plastic-sequins-seq0107</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-2-14-2-32_product_1_1643790752793.jpg?v=1643790758</image:loc>
      <image:title>Dull Golden Bowl Plastic Sequins</image:title>
      <image:caption>dull-golden-color-katori-shape-mm-plastic-sequins-seq0107</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/paani-ar-color-katori-shape-plastic-sequins-seq0108</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-2-14-10-35_product_1_1643791235855.jpg?v=1643791240</image:loc>
      <image:title>White Transparent Rainbow Bowl Plastic Sequins</image:title>
      <image:caption>paani-ar-color-katori-shape-plastic-sequins-seq0108</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-pearl-v-17-color-katori-shape-plastic-sequins-seq0109</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-2-15-23-32_product_1_1643795612536.jpg?v=1643795617</image:loc>
      <image:title>White Pearl Bowl Plastic Sequins</image:title>
      <image:caption>white-pearl-v-17-color-katori-shape-plastic-sequins-seq0109</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/rose-gold-zari-color-katori-shape-plastic-sequins-seq0110</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-2-15-25-4_product_1_1643795704345.jpg?v=1643795709</image:loc>
      <image:title>Rose Gold Zari Bowl Plastic Sequins</image:title>
      <image:caption>rose-gold-zari-color-katori-shape-plastic-sequins-seq0110</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/paani-clear-color-katori-shape-plastic-sequins-seq0111</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-2-15-27-39_product_1_1643795859869.jpg?v=1643795865</image:loc>
      <image:title>Transparent Water Gold Bowl Plastic Sequins</image:title>
      <image:caption>paani-clear-color-katori-shape-plastic-sequins-seq0111</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-golden-mr-color-katori-shape-plastic-sequins-seq0113</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-2-15-29-46_product_1_1643795986137.jpg?v=1643795991</image:loc>
      <image:title>Dark Golden Bowl Plastic Sequins</image:title>
      <image:caption>dark-golden-mr-color-katori-shape-plastic-sequins-seq0113</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-paani-clear-color-katori-shape-plastic-sequins-seq0114</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-2-15-31-27_product_1_1643796087219.jpg?v=1643796092</image:loc>
      <image:title>White Transparent Bowl Plastic Sequins</image:title>
      <image:caption>white-paani-clear-color-katori-shape-plastic-sequins-seq0114</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/medium-golden-french-franc-cut-sewon-sequins-pailletes-spangles-seqfc0001</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-2-15-52-0_product_1_1643797320459.jpg?v=1643797325</image:loc>
      <image:title>Pastel Golden Flat Circular Plastic Sequins</image:title>
      <image:caption>medium-golden-french-franc-cut-sewon-sequins-pailletes-spangles-seqfc0001</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-golden-french-franc-cut-sewon-sequins-pailletes-spangles-seqfc0002</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-2-15-53-49_product_1_1643797429099.jpg?v=1643797434</image:loc>
      <image:title>Light Golden Flat Circular Plastic Sequins</image:title>
      <image:caption>light-golden-french-franc-cut-sewon-sequins-pailletes-spangles-seqfc0002</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dull-golden-french-franc-cut-sewon-sequins-pailletes-spangles-seqfc0003</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-2-15-57-28_product_1_1643797648713.jpg?v=1643797653</image:loc>
      <image:title>Dull Golden Flat Circular Plastic Sequins</image:title>
      <image:caption>dull-golden-french-franc-cut-sewon-sequins-pailletes-spangles-seqfc0003</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-golden-mr-french-franc-cut-sewon-sequins-pailletes-spangles-seqfc0005</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-2-16-17-21_product_1_1643798841730.jpg?v=1643798846</image:loc>
      <image:title>Light Golden Flat Circular Plastic Sequins</image:title>
      <image:caption>light-golden-mr-french-franc-cut-sewon-sequins-pailletes-spangles-seqfc0005</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-french-franc-cut-sewon-sequins-pailletes-spangles-seqfc0006</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-2-16-20-14_product_1_1643799014305.jpg?v=1643799018</image:loc>
      <image:title>Silver Flat Circular Plastic Sequins</image:title>
      <image:caption>silver-french-franc-cut-sewon-sequins-pailletes-spangles-seqfc0006</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/navy-black-combi-broach</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-3-16-39-2_product_1_1643886542566.jpg?v=1643886546</image:loc>
      <image:title>Navy Blue Designer Brooches</image:title>
      <image:caption>navy-black-combi-broach</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multi-colour-clip-for-garments</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-3-16-43-19_product_1_1643886799711.jpg?v=1643886802</image:loc>
      <image:title>Multicolour Clip Brooches</image:title>
      <image:caption>multi-colour-clip-for-garments</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multi-colour-broach-with-heart-design-and-black-colour-base</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-3-17-1-4_product_1_1643887864480.jpg?v=1643887868</image:loc>
      <image:title>Black Multicolour Heart Designer Brooch</image:title>
      <image:caption>multi-colour-broach-with-heart-design-and-black-colour-base</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-a-ntique-broach-with-black-ribbon-flower-hanging</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-3-17-30-20_product_1_1643889620271.jpg?v=1643889623</image:loc>
      <image:title>Antique Black Designer Brooch</image:title>
      <image:caption>black-a-ntique-broach-with-black-ribbon-flower-hanging</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-colour-clip-with-heart-design-on-it</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-3-18-15-18_product_1_1643892318366.jpg?v=1643892321</image:loc>
      <image:title>White Heart Designer Clip Brooch</image:title>
      <image:caption>white-colour-clip-with-heart-design-on-it</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-clip-with-red-white-navy-combi-making-it-look-elegant</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-3-18-23-44_product_1_1643892824455.jpg?v=1643892828</image:loc>
      <image:title>Black Red Navy Blue Designer Clip Brooch</image:title>
      <image:caption>black-clip-with-red-white-navy-combi-making-it-look-elegant</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-colour-clip-with-white-and-red-effect-on-it</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-3-18-35-33_product_1_1643893533166.jpg?v=1643893536</image:loc>
      <image:title>Black White Red Designer Clip Brooch</image:title>
      <image:caption>black-colour-clip-with-white-and-red-effect-on-it</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-multicolour-clip-with-triangle-design-on-it</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-3-18-44-14_product_1_1643894054044.jpg?v=1643894057</image:loc>
      <image:title>Black Multicolour Triangular Clip Brooches</image:title>
      <image:caption>black-multicolour-clip-with-triangle-design-on-it</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-colur-anchor-shape-broach</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-3-19-1-10_product_1_1643895070240.jpg?v=1643895073</image:loc>
      <image:title>Red Anchor Designer Brooch</image:title>
      <image:caption>red-colur-anchor-shape-broach</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-organic-cotton-handloom-chatai-design-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-4-11-11-2_product_2_1643953262082.jpg?v=1671437829</image:loc>
      <image:title>White Self Checks Organic Handloom Cotton Fabric</image:title>
      <image:caption>white-organic-cotton-handloom-chatai-design-cotton-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/round-wooden-button-2holed-and-18mm-dia-for-adding-glamour-to-ethic-wear-sewing-and-decorations</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-4-17-20-33_product_1_1643975433226.jpg?v=1643975435</image:loc>
      <image:title>Brown 2 Hole Designer Wooden Buttons</image:title>
      <image:caption>round-wooden-button-2holed-and-18mm-dia-for-adding-glamour-to-ethic-wear-sewing-and-decorations</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-multicolored-kantha-work-embroidered-chanderi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-5-12-59-32_product_1_1644046172684.jpg?v=1644046209</image:loc>
      <image:title>Peach Multicolour Kantha Work Flowers Embroidered Chanderi Fabric</image:title>
      <image:caption>peach-multicolored-kantha-work-embroidered-chanderi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/bottle-green-sequins-and-multicolored-embroidered-border</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-5-13-3-40_product_1_1644046420261.jpg?v=1644046444</image:loc>
      <image:title>Bottle Green Multicolour Thread and Sequins Work Embroidered Border</image:title>
      <image:caption>bottle-green-sequins-and-multicolored-embroidered-border</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-silver-embroidered-lace</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-5-13-15-28_product_1_1644047128153.jpg?v=1644047148</image:loc>
      <image:title>Black Silver Paisleys Thread and Sequins Work Embroidered Lace</image:title>
      <image:caption>black-silver-embroidered-lace</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/wooden-round-button-with-mickey-design-on-it</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-5-16-13-41_product_1_1644057821563.jpg?v=1644057827</image:loc>
      <image:title>Brown Black Mickey Mouse Printed 2 Hole Wooden Buttons</image:title>
      <image:caption>wooden-round-button-with-mickey-design-on-it</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/round-button-made-of-wooden-material-for-ethic-wear-art-and-decoration-bags-and-many-more</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-5-16-30-43_product_1_1644058843782.jpg?v=1644058849</image:loc>
      <image:title>Light Brown Fancy 2 Hole Wooden Buttons</image:title>
      <image:caption>round-button-made-of-wooden-material-for-ethic-wear-art-and-decoration-bags-and-many-more</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-glass-beads-hanging-8-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-5-17-36-59_product_1_1644062819375.jpg?v=1644062823</image:loc>
      <image:title>Golden Glass Beads Hanging- 8 mm</image:title>
      <image:caption>golden-glass-beads-hanging-8-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-glass-beads-hanging-8-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-5-17-37-20_product_1_1644062840236.jpg?v=1644062843</image:loc>
      <image:title>Silver Glass Beads Hanging- 8 mm</image:title>
      <image:caption>silver-glass-beads-hanging-8-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/gary-glass-beads-hanging-8-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-5-17-39-28_product_1_1644062968960.jpg?v=1644062972</image:loc>
      <image:title>Gray Glass Beads Hanging - 8 mm</image:title>
      <image:caption>gary-glass-beads-hanging-8-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/purple-glass-beads-hanging</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-5-17-41-19_product_1_1644063079454.jpg?v=1644063083</image:loc>
      <image:title>Purple Glass Beads Hanging- 8 mm</image:title>
      <image:caption>purple-glass-beads-hanging</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-glass-bead-hanging-8-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-5-17-44-4_product_1_1644063244132.jpg?v=1644063248</image:loc>
      <image:title>Pink Glass Bead Hanging - 8 mm</image:title>
      <image:caption>pink-glass-bead-hanging-8-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-glass-beads-hanging-10-mmm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-7-11-35-38_product_1_1644213938365.jpg?v=1644213943</image:loc>
      <image:title>Red Glass Beads Hanging - 10 mm</image:title>
      <image:caption>red-glass-beads-hanging-10-mmm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/beige-glass-bead-hanging-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-7-11-38-37_product_1_1644214117607.jpg?v=1644214122</image:loc>
      <image:title>Beige Glass Bead Hanging- 10 mm</image:title>
      <image:caption>beige-glass-bead-hanging-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-glass-bead-hanging-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-7-11-41-30_product_1_1644214290576.jpg?v=1644214295</image:loc>
      <image:title>Blue Glass Bead Hanging - 10 mm</image:title>
      <image:caption>blue-glass-bead-hanging-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/brown-glass-beads-hanging-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-7-11-43-24_product_1_1644214404903.jpg?v=1644214409</image:loc>
      <image:title>Brown Glass Beads Hanging- 10 mm</image:title>
      <image:caption>brown-glass-beads-hanging-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/sky-blue-glass-beads-hanging-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-7-11-45-34_product_1_1644214534028.jpg?v=1644214539</image:loc>
      <image:title>Sky Blue Glass Beads Hanging - 10 mm</image:title>
      <image:caption>sky-blue-glass-beads-hanging-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-glass-beads-hanging-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-7-11-47-5_product_1_1644214625566.jpg?v=1644214630</image:loc>
      <image:title>Silver Glass Beads Hanging - 10 mm</image:title>
      <image:caption>silver-glass-beads-hanging-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/navy-glass-beads-hanging-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-7-11-48-51_product_1_1644214731869.jpg?v=1644214737</image:loc>
      <image:title>Navy Blue Glass Beads Hanging - 10 mm</image:title>
      <image:caption>navy-glass-beads-hanging-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-glass-beads-hanging-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-7-11-50-46_product_1_1644214846872.jpg?v=1644214851</image:loc>
      <image:title>Blue Glass Beads Hanging - 10 mm</image:title>
      <image:caption>blue-glass-beads-hanging-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-glass-beads-hanging-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-7-11-53-28_product_1_1644215008599.jpg?v=1644215016</image:loc>
      <image:title>White Glass Beads Hanging - 10 mm</image:title>
      <image:caption>white-glass-beads-hanging-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/off-white-glass-beads-hanging-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-7-11-57-11_product_1_1644215231983.jpg?v=1644215237</image:loc>
      <image:title>Off White Glass Beads Hanging - 10 mm</image:title>
      <image:caption>off-white-glass-beads-hanging-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-green-glass-beads-hanging-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-7-11-59-21_product_1_1644215361445.jpg?v=1644215366</image:loc>
      <image:title>Black Glass Beads Hanging - 10 mm</image:title>
      <image:caption>dark-green-glass-beads-hanging-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-glass-beads-hanging-10-mm-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-7-12-1-58_product_1_1644215518320.jpg?v=1644215524</image:loc>
      <image:title>Cream Glass Beads Hanging - 10 mm</image:title>
      <image:caption>white-glass-beads-hanging-10-mm-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-glass-beads-hanging-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-7-12-3-50_product_1_1644215630692.jpg?v=1644215636</image:loc>
      <image:title>Peach Glass Beads Hanging- 10 mm</image:title>
      <image:caption>peach-glass-beads-hanging-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-blue-glass-beads-hanging-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-7-12-5-35_product_1_1644215735073.jpg?v=1644215740</image:loc>
      <image:title>Light Blue Glass Beads Hanging - 10 mm</image:title>
      <image:caption>light-blue-glass-beads-hanging-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/gray-glass-beads-hanging-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-7-12-8-1_product_1_1644215881106.jpg?v=1644215886</image:loc>
      <image:title>Gray Glass Beads Hanging - 10 mm</image:title>
      <image:caption>gray-glass-beads-hanging-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-satin-border-with-grey-dori-embroidery</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-7-12-52-50_product_1_1644218570821.jpg?v=1644218578</image:loc>
      <image:title>Black Gray Thread Work Embroidered Border</image:title>
      <image:caption>black-satin-border-with-grey-dori-embroidery</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/round-wooden-button-with-flower-design-on-it-to-add-beauty-to-your-garments-and-art-and-craft</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-7-16-7-36_product_1_1644230256529.jpg?v=1644230259</image:loc>
      <image:title>Brown Flower Circular 2 Hole Wooden Button</image:title>
      <image:caption>round-wooden-button-with-flower-design-on-it-to-add-beauty-to-your-garments-and-art-and-craft</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/round-wooden-button-with-flower-design-on-it-for-ethic-wear-sewing-and-art-and-craft</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-7-16-33-29_product_1_1644231809767.jpg?v=1644231813</image:loc>
      <image:title>Brown Circular Flower Printed 2 Hole Wooden Button</image:title>
      <image:caption>round-wooden-button-with-flower-design-on-it-for-ethic-wear-sewing-and-art-and-craft</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-brown-screen-printed-viscose-chanderi-lurex-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-22-11-3-24_product_1_1645508004350.jpg?v=1645534107</image:loc>
      <image:title>Golden Brown Motifs Screen Printed Viscose Chanderi Lurex Fabric</image:title>
      <image:caption>golden-brown-screen-printed-viscose-chanderi-lurex-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-assorted-pasting-kundan-stones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-9-14-36-29_product_1_1644397589135.jpg?v=1644397594</image:loc>
      <image:title>Multicolour Assorted Pasting Kundan Stones</image:title>
      <image:caption>multicolor-assorted-pasting-kundan-stones</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-metal-ball-chain</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-9-14-39-32_product_1_1644397772268.jpg?v=1644397777</image:loc>
      <image:title>Golden Metal Ball Chain</image:title>
      <image:caption>golden-metal-ball-chain</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/b-6000-glue-for-jewerly-making</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/WhatsAppImage2023-11-08at14.22.47.jpg?v=1699435697</image:loc>
      <image:title>B-6000 / B-7000 Glue for Jewerly Making</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-round-spacer-bead-with-crystal-6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-9-15-4-6_product_1_1644399246304.jpg?v=1748243122</image:loc>
      <image:title>Golden Round Spacer Bead with Crystal- 6 mm</image:title>
      <image:caption>golden-round-spacer-bead-with-crystal-6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-flower-metal-beads-cap-6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-9-15-6-29_product_1_1644399389140.jpg?v=1644399397</image:loc>
      <image:title>Golden Flower Metal Beads Cap- 6 mm</image:title>
      <image:caption>golden-flower-metal-beads-cap-6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-cupchain-with-silver-base-7-ss</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-9-15-9-1_product_1_1644399541629.jpg?v=1644399547</image:loc>
      <image:title>Blue Cup Chain with Silver Base- 7 ss</image:title>
      <image:caption>blue-cupchain-with-silver-base-7-ss</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-cupchain-with-golden-base-7-ss</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-9-15-10-33_product_1_1644399633514.jpg?v=1644399638</image:loc>
      <image:title>Blue Cup Chain with Golden Base- 7 ss</image:title>
      <image:caption>blue-cupchain-with-golden-base-7-ss</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-blue-cupchain-with-golden-base-7-ss</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-9-15-19-40_product_1_1644400180571.jpg?v=1644400185</image:loc>
      <image:title>Light Blue Cup Chain with Golden Base- 7 ss</image:title>
      <image:caption>light-blue-cupchain-with-golden-base-7-ss</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/emeralad-green-cupchain-with-golden-base-7-ss</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-9-15-21-37_product_1_1644400297490.jpg?v=1644400302</image:loc>
      <image:title>Emerald Green Cup Chain with Golden Base- 7 ss</image:title>
      <image:caption>emeralad-green-cupchain-with-golden-base-7-ss</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-blue-oval-evil-eyes-glass-beads-10x8-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-15-15-55-26_product_1_1644920726157.jpg?v=1644920790</image:loc>
      <image:title>Dark Blue Oval Evil Eye Glass Beads -10x8 mm</image:title>
      <image:caption>dark-blue-oval-evil-eyes-glass-beads-10x8-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-white-loreal-beads-3-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-9-15-32-8_product_1_1644400928236.jpg?v=1644400934</image:loc>
      <image:title>White Golden Loreal Beads- 3 mm</image:title>
      <image:caption>golden-white-loreal-beads-3-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pastel-green-sequins-and-zari-work-embroidered-border</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/50C.png?v=1743576481</image:loc>
      <image:title>Pastel Green Sequins and Zari Work Embroidered Border</image:title>
      <image:caption>pastel-green-sequins-and-zari-work-embroidered-border</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/organic-cotton-yellowish-red-plain-sober-dye-dt-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-16-7-0-31_product_2_1644975031778.jpg?v=1671437692</image:loc>
      <image:title>Rust Red Plain Dyed Organic Cotton Fabric</image:title>
      <image:caption>organic-cotton-yellowish-red-plain-sober-dye-dt-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-chevron-hand-screen-printed-green-viscose-muslin-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-16-17-42-16_product_1_1645013536786.jpg?v=1645013541</image:loc>
      <image:title>Green White Chevron Hand Screen Printed Viscose Muslin Silk Fabric</image:title>
      <image:caption>white-chevron-hand-screen-printed-green-viscose-muslin-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-polka-dots-pink-modal-satin-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-16-18-22-19_product_1_1645015939660.jpg?v=1645015944</image:loc>
      <image:title>Pink White Polka Dots Printed Modal Satin Fabric</image:title>
      <image:caption>white-polka-dots-pink-modal-satin-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/28l-pink-colour-round-wooden-button-making-it-look-vibrant</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-17-17-59-55_product_1_1645100995895.jpg?v=1645100999</image:loc>
      <image:title>Pink Designer 4 Hole Wooden Buttons</image:title>
      <image:caption>28l-pink-colour-round-wooden-button-making-it-look-vibrant</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-dots-bandhej-style-grey-viscose-chanderi-lurex-hand-screen-printed-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-17-18-29-45_product_1_1645102785574.jpg?v=1645102792</image:loc>
      <image:title>Gray White Dot Bandhej Printed Viscose Chanderi Lurex Fabric</image:title>
      <image:caption>white-dots-bandhej-style-grey-viscose-chanderi-lurex-hand-screen-printed-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/round-shaped-pink-color-wooden-button-with-tree-design-on-it</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-17-20-34-31_product_1_1645110271443.jpg?v=1645110275</image:loc>
      <image:title>Pink Beige Tree Printed 2 Hole Wooden Buttons</image:title>
      <image:caption>round-shaped-pink-color-wooden-button-with-tree-design-on-it</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-color-round-shaped-wooden-button-with-tree-design-on-it</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-17-20-37-16_product_1_1645110436063.jpg?v=1645110440</image:loc>
      <image:title>Blue Beige Tree Printed 2 Hole Wooden Buttons</image:title>
      <image:caption>blue-color-round-shaped-wooden-button-with-tree-design-on-it</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/round-shaped-yellow-color-wooden-button-with-tree-deisgn-on-it</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-17-20-41-7_product_1_1645110667959.jpg?v=1645110673</image:loc>
      <image:title>Yellow Beige Tree Printed 2 Hole Wooden Buttons</image:title>
      <image:caption>round-shaped-yellow-color-wooden-button-with-tree-deisgn-on-it</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-color-round-shaped-wooden-button-with-tree-design-on-it</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-17-20-48-9_product_1_1645111089256.jpg?v=1645111093</image:loc>
      <image:title>Green Beige Tree Printed 2 Hole Wooden Buttons</image:title>
      <image:caption>green-color-round-shaped-wooden-button-with-tree-design-on-it</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/32l-round-shaped-wooden-button-with-four-holes-and-pink-touch-on-it</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-17-20-52-47_product_1_1645111367123.jpg?v=1645111371</image:loc>
      <image:title>Beige Pink 4 Hole Wooden Buttons</image:title>
      <image:caption>32l-round-shaped-wooden-button-with-four-holes-and-pink-touch-on-it</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/32l-round-shaped-wooden-button-with-blue-touch-on-it</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-17-20-56-14_product_1_1645111574163.jpg?v=1645111579</image:loc>
      <image:title>Beige Blue 4 Hole Wooden Buttons</image:title>
      <image:caption>32l-round-shaped-wooden-button-with-blue-touch-on-it</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-white-paws-kids-print-pure-cotton-rayon-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-18-14-33-20_product_1_1645175000807.jpg?v=1645175007</image:loc>
      <image:title>Pink White Paws Printed Cotton Rayon Fabric</image:title>
      <image:caption>pink-white-paws-kids-print-pure-cotton-rayon-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-color-round-wooden-button-to-suit-best-with-your-outfit</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-19-15-9-6_product_1_1645263546696.jpg?v=1645263550</image:loc>
      <image:title>Red 4 Hole Wooden Buttons</image:title>
      <image:caption>red-color-round-wooden-button-to-suit-best-with-your-outfit</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/28l-yellow-color-wooden-button-that-will-best-with-your-outfit</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-19-15-12-42_product_1_1645263762228.jpg?v=1645263766</image:loc>
      <image:title>Yellow 4 Hole Wooden Buttons</image:title>
      <image:caption>28l-yellow-color-wooden-button-that-will-best-with-your-outfit</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dul-gold</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-17-37-12_product_1_1645618032348.jpg?v=1646294800</image:loc>
      <image:title>Uni Golden Round Rocaille Glass Seed Beads</image:title>
      <image:caption>dul-gold</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-color-28l-wooden-button-that-will-suits-your-outfit</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-19-15-16-12_product_1_1645263972186.jpg?v=1645263976</image:loc>
      <image:title>Blue 4 Hole Wooden Buttons</image:title>
      <image:caption>blue-color-28l-wooden-button-that-will-suits-your-outfit</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-color-wooden-button-to-make-your-outfit-look-vibrant</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-19-15-21-48_product_1_1645264308863.jpg?v=1645264313</image:loc>
      <image:title>Pink 4 Hole Wooden Buttons</image:title>
      <image:caption>pink-color-wooden-button-to-make-your-outfit-look-vibrant</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/round-shaped-red-color-wooden-button-that-will-suit-best-with-your-outfit</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-19-15-33-48_product_1_1645265028907.jpg?v=1645265040</image:loc>
      <image:title>Red Designer 4 Hole Wooden Buttons</image:title>
      <image:caption>round-shaped-red-color-wooden-button-that-will-suit-best-with-your-outfit</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-white-chikankari-embroidered-chanderi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-21-21-30-39_product_1_1645459239761.jpg?v=1645459254</image:loc>
      <image:title>Pink White Flowers Chikankari Embroidered Chanderi Fabric</image:title>
      <image:caption>pink-white-chikankari-embroidered-chanderi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-tear-drop-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-22-16-51-34_product_1_1645528894143.jpg?v=1645528921</image:loc>
      <image:title>Multicolour Rainbow Drop Czech Glass Beads - 12x4 mm</image:title>
      <image:caption>fancy-tear-drop-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-faceted-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-22-17-7-35_product_1_1645529855251.jpg?v=1645529881</image:loc>
      <image:title>Red Rondelle / Tyre Faceted Czech Glass Crystal Beads</image:title>
      <image:caption>fancy-faceted-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-faceted-glass-beads-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-22-17-14-29_product_1_1645530269012.jpg?v=1645530295</image:loc>
      <image:title>White Rondelle / Tyre Faceted Czech Glass Crystal Beads</image:title>
      <image:caption>fancy-faceted-glass-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-bi-cone-glass-beads-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-22-17-23-48_product_1_1645530828987.jpg?v=1645530854</image:loc>
      <image:title>Multicolour Rainbow Fancy Bicone Czech Glass Crystal Beads</image:title>
      <image:caption>fancy-bi-cone-glass-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-bi-cone-glass-beads-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-22-17-30-25_product_1_1645531225774.jpg?v=1645531251</image:loc>
      <image:title>Blue Fancy Bicone Czech Glass Crystal Beads</image:title>
      <image:caption>fancy-bi-cone-glass-beads-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-faceted-glass-beads-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-22-17-38-37_product_1_1645531717152.jpg?v=1645531742</image:loc>
      <image:title>Silver Rondelle / Tyre Faceted Czech Glass Crystal Beads</image:title>
      <image:caption>fancy-faceted-glass-beads-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-faceted-glass-beads-3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-22-17-43-24_product_1_1645532004511.jpg?v=1645532030</image:loc>
      <image:title>Baby Pink Rondelle / Tyre Faceted Czech Glass Crystal Beads</image:title>
      <image:caption>fancy-faceted-glass-beads-3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-faceted-glass-beads-4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-22-17-48-47_product_1_1645532327934.jpg?v=1645532353</image:loc>
      <image:title>Light Blue Rondelle / Tyre Faceted Czech Glass Crystal Beads</image:title>
      <image:caption>fancy-faceted-glass-beads-4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-faceted-glass-beads-5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-22-17-55-0_product_1_1645532700118.jpg?v=1645532725</image:loc>
      <image:title>Silver Metallic Rondelle / Tyre Faceted Czech Glass Crystal Beads</image:title>
      <image:caption>fancy-faceted-glass-beads-5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-faceted-glass-beads-6</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-22-17-59-53_product_1_1645532993677.jpg?v=1645533019</image:loc>
      <image:title>Blue Rainbow Rondelle / Tyre Faceted Czech Glass Crystal Beads</image:title>
      <image:caption>fancy-faceted-glass-beads-6</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-faceted-glass-beads-8</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-22-18-16-59_product_1_1645534019002.jpg?v=1645534044</image:loc>
      <image:title>Copper Rondelle / Tyre Faceted Czech Glass Crystal Beads</image:title>
      <image:caption>fancy-faceted-glass-beads-8</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-bi-cone-glass-beads-3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-22-18-24-42_product_1_1645534482209.jpg?v=1645534508</image:loc>
      <image:title>Silver Rondelle / Tyre Czech Glass Crystal Beads</image:title>
      <image:caption>fancy-bi-cone-glass-beads-3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-facetedglass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-22-18-31-16_product_1_1645534876440.jpg?v=1645534902</image:loc>
      <image:title>Blue Rondelle / Tyre Faceted Czech Glass Crystal Beads</image:title>
      <image:caption>fancy-facetedglass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-button-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-22-18-44-8_product_1_1645535648015.jpg?v=1645535673</image:loc>
      <image:title>Blue Flat Circular Czech Glass Beads</image:title>
      <image:caption>fancy-button-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/advance-light-green-inside-colour</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-17-27-9_product_1_1645617429638.jpg?v=1645617440</image:loc>
      <image:title>Light Green Inside Colour Round Rocaille Glass Seed Beads</image:title>
      <image:caption>advance-light-green-inside-colour</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-round-glass-beads-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-11-1-1_product_1_1645594261316.jpg?v=1645594289</image:loc>
      <image:title>Green Fancy Circular Czech Glass Beads - 6 mm</image:title>
      <image:caption>fancy-round-glass-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pre-cut-leopard-digitally-printed-georgette-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/White_Black_Leopard_Digitally_Printed_Georgette_Fabric_product_1_1622817147620_19cc5e0b-6266-4448-a25a-1bde6da6d00e.jpg?v=1645594319</image:loc>
      <image:title>Precut Of 1 Meter Leopard Digitally Printed Georgette Fabric</image:title>
      <image:caption>white-black-leopard-digitally-printed-georgette-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-oval-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-12-40-38_product_1_1645600238537.jpg?v=1645600266</image:loc>
      <image:title>Dark Green Oval Czech Glass Beads - 14x11 mm</image:title>
      <image:caption>fancy-oval-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-bicone-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-12-54-26_product_1_1645601066545.jpg?v=1645601094</image:loc>
      <image:title>Light Green Bicone Czech Glass Beads- 9x9 mm</image:title>
      <image:caption>fancy-bicone-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-rounded-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-13-34-37_product_1_1645603477572.jpg?v=1645603506</image:loc>
      <image:title>Dark Green Circular Czech Glass Beads - 7x7 mm</image:title>
      <image:caption>fancy-rounded-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-tear-drop-glass-beads-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-13-39-8_product_1_1645603748863.jpg?v=1645603775</image:loc>
      <image:title>Dark Turquoise Drop Czech Glass Beads - 9x7 mm</image:title>
      <image:caption>fancy-tear-drop-glass-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-rounded-glass-beads-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-14-3-9_product_1_1645605189513.jpg?v=1645605217</image:loc>
      <image:title>Turquoise Spherical Czech Glass Beads - 12x13 mm</image:title>
      <image:caption>fancy-rounded-glass-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-rounded-glass-beads-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-14-11-34_product_1_1645605694696.jpg?v=1645605723</image:loc>
      <image:title>Dark Green Spherical Czech Glass Beads</image:title>
      <image:caption>fancy-rounded-glass-beads-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-color-four-hole-wooden-button-tht-will-suit-with-dresses-diy-art-and-craft-and-more</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-14-15-43_product_1_1645605943639.jpg?v=1645605948</image:loc>
      <image:title>Yellow Designer 4 Hole Wooden Buttons</image:title>
      <image:caption>yellow-color-four-hole-wooden-button-tht-will-suit-with-dresses-diy-art-and-craft-and-more</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-rounded-glass-beads-4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-14-17-43_product_1_1645606063711.jpg?v=1645606091</image:loc>
      <image:title>Light Green Transparent Spherical Czech Glass Beads</image:title>
      <image:caption>fancy-rounded-glass-beads-4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/28l-blue-color-wooden-button-that-can-used-in-sewing-art-and-craft-and-many-more</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-14-19-4_product_1_1645606144392.jpg?v=1645606149</image:loc>
      <image:title>Blue Designer 4 Hole Wooden Buttons</image:title>
      <image:caption>28l-blue-color-wooden-button-that-can-used-in-sewing-art-and-craft-and-many-more</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-color-wooden-button-size-of-28l-which-can-used-for-garments-art-and-craft-and-many-more</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-14-24-56_product_1_1645606496279.jpg?v=1645606501</image:loc>
      <image:title>Green Designer 4 Hole Wooden Buttons</image:title>
      <image:caption>green-color-wooden-button-size-of-28l-which-can-used-for-garments-art-and-craft-and-many-more</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-rounded-glass-beads-5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-14-36-59_product_1_1645607219876.jpg?v=1645607247</image:loc>
      <image:title>Light Green Spherical Czech Glass Beads</image:title>
      <image:caption>fancy-rounded-glass-beads-5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-rounded-glass-beads-6</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-14-39-55_product_1_1645607395851.jpg?v=1645607424</image:loc>
      <image:title>Light Blue Spherical Czech Glass Beads</image:title>
      <image:caption>fancy-rounded-glass-beads-6</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/round-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-14-44-8_product_1_1645607648335.jpg?v=1645607676</image:loc>
      <image:title>Light Green Spherical Czech Glass Beads- 6x7 mm</image:title>
      <image:caption>round-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-cylindrical-glass-beads-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-14-51-51_product_1_1645608111591.jpg?v=1645608141</image:loc>
      <image:title>Light Green Fancy Cylindrical Czech Glass Beads</image:title>
      <image:caption>fancy-cylindrical-glass-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-round-glass-beads-4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-15-0-21_product_1_1645608621376.jpg?v=1645608649</image:loc>
      <image:title>Dark Green Spherical Czech Glass Beads- 7x8 mm</image:title>
      <image:caption>fancy-round-glass-beads-4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-oval-glass-beads-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-15-17-27_product_1_1645609647116.jpg?v=1645609675</image:loc>
      <image:title>Dusty Green Oval Czech Glass Beads - 8x10 mm</image:title>
      <image:caption>fancy-oval-glass-beads-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-roundal-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-15-22-14_product_1_1645609934937.jpg?v=1645609963</image:loc>
      <image:title>Light Green Transparent Circular Czech Glass Beads - 6x8 mm</image:title>
      <image:caption>fancy-roundal-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-bicone-glass-beads-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-15-28-12_product_1_1645610292711.jpg?v=1645610320</image:loc>
      <image:title>Green Transparent Bicone Czech Glass Beads - 10x11 mm</image:title>
      <image:caption>fancy-bicone-glass-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-oval-glass-beads-3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-15-40-30_product_1_1645611030915.jpg?v=1645611058</image:loc>
      <image:title>Turquoise Green Oval Czech Glass Beads - 6x8 mm</image:title>
      <image:caption>fancy-oval-glass-beads-3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/turquoise-faceted-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-18-11-40_product_1_1645620100475.jpg?v=1645620107</image:loc>
      <image:title>Turquoise Faceted Bicone Czech Glass Crystal Beads- 4 mm</image:title>
      <image:caption>turquoise-faceted-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-faceted-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-18-12-28_product_1_1645620148545.jpg?v=1645620155</image:loc>
      <image:title>Black Faceted Bicone Crystal Czech Glass Beads</image:title>
      <image:caption>black-faceted-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/topaz-faceted-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-18-13-45_product_1_1645620225441.jpg?v=1645620232</image:loc>
      <image:title>Topaz Brown Bicone Faceted Crystal Czech Glass Beads</image:title>
      <image:caption>topaz-faceted-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/turquoise-faceted-glass-beads-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-18-17-13_product_1_1645620433876.jpg?v=1645620441</image:loc>
      <image:title>Turquoise Rondelle / Tyre Faceted Crystal Czech Glass Beads</image:title>
      <image:caption>turquoise-faceted-glass-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-faceted-glass-beads-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-18-18-37_product_1_1645620517502.jpg?v=1645620523</image:loc>
      <image:title>Black Rondelle / Tyre Faceted Crystal Czech Glass Beads</image:title>
      <image:caption>black-faceted-glass-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/topaz-faceted-glass-beads-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-18-19-25_product_1_1645620565061.jpg?v=1645620573</image:loc>
      <image:title>Topaz Brown Rondelle / Tyre Faceted Crystal Czech Glass Beads</image:title>
      <image:caption>topaz-faceted-glass-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/topaz-faceted-glass-beads-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-18-20-11_product_1_1645620611806.jpg?v=1645620622</image:loc>
      <image:title>Topaz Brown Rondelle / Tyre Faceted Crystal Czech Glass Beads - 4x6 mm</image:title>
      <image:caption>topaz-faceted-glass-beads-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-faceted-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-18-23-41_product_1_1645620821498.jpg?v=1645620828</image:loc>
      <image:title>Pink Rondelle / Tyre Faceted Crystal Czech Glass Beads</image:title>
      <image:caption>pink-faceted-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/turquoise-faceted-glass-beads-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-18-25-10_product_1_1645620910929.jpg?v=1645620917</image:loc>
      <image:title>Turquoise Rondelle / Tyre Faceted Crystal Czech Glass Beads</image:title>
      <image:caption>turquoise-faceted-glass-beads-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-blue-faceted-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-18-25-54_product_1_1645620954084.jpg?v=1645620961</image:loc>
      <image:title>Light Blue Rondelle / Tyre Faceted Crystal Czech Glass Beads</image:title>
      <image:caption>light-blue-faceted-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-faceted-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-18-26-34_product_1_1645620994500.jpg?v=1645621001</image:loc>
      <image:title>Blue Rondelle / Tyre Faceted Crystal Czech Glass Beads</image:title>
      <image:caption>blue-faceted-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-blue-faceted-glass-beads-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-18-32-10_product_1_1645621330993.jpg?v=1645621338</image:loc>
      <image:title>Light Pastel Blue Rondelle / Tyre Faceted Crystal Czech Glass Beads</image:title>
      <image:caption>light-blue-faceted-glass-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-faceted-glass-beads-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-18-32-52_product_1_1645621372177.jpg?v=1645621379</image:loc>
      <image:title>Deep Blue Rondelle / Tyre Faceted Crystal Czech Glass Beads</image:title>
      <image:caption>blue-faceted-glass-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/turquoise-faceted-glass-beads-3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-18-33-20_product_1_1645621400942.jpg?v=1645621408</image:loc>
      <image:title>Turquoise Rondelle / Tyre Faceted Crystal Czech Glass Beads- 6x8 mm</image:title>
      <image:caption>turquoise-faceted-glass-beads-3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/topaz-faceted-glass-beads-3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-18-33-54_product_1_1645621434667.jpg?v=1645621442</image:loc>
      <image:title>Topaz Brown Rondelle / Tyre Faceted Crystal Czech Glass Beads- 6x8 mm</image:title>
      <image:caption>topaz-faceted-glass-beads-3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-blue-faceted-glass-beads-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-19-22-40_product_1_1645624360974.jpg?v=1645624367</image:loc>
      <image:title>Light Blue Faceted Czech Glass Crystal Beads- 8x10 mm</image:title>
      <image:caption>light-blue-faceted-glass-beads-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-faceted-glass-beads-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-19-23-56_product_1_1645624436150.jpg?v=1645624443</image:loc>
      <image:title>Blue Faceted Czech Glass Crystal Beads- 8x10 mm</image:title>
      <image:caption>blue-faceted-glass-beads-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/turquoise-faceted-glass-beads-4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-19-25-17_product_1_1645624517190.jpg?v=1645624525</image:loc>
      <image:title>Turquoise Faceted Czech Glass Crystal Beads- 8x10 mm</image:title>
      <image:caption>turquoise-faceted-glass-beads-4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/grey-faceted-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-19-26-19_product_1_1645624579757.jpg?v=1645624587</image:loc>
      <image:title>Gray Faceted Czech Glass Crystal Beads- 8x10 mm</image:title>
      <image:caption>grey-faceted-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-faceted-glass-beads-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-19-27-3_product_1_1645624623261.jpg?v=1645624630</image:loc>
      <image:title>Black Faceted Czech Glass Crystal Beads- 8x10 mm</image:title>
      <image:caption>black-faceted-glass-beads-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/topaz-faceted-glass-beads-4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-19-27-44_product_1_1645624664400.jpg?v=1645624675</image:loc>
      <image:title>Topaz Brown Faceted Czech Glass Crystal Beads- 8x10 mm</image:title>
      <image:caption>topaz-faceted-glass-beads-4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/turquoise-faceted-glass-beads-5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-19-46-29_product_1_1645625789441.jpg?v=1645625797</image:loc>
      <image:title>Light Turquoise Faceted Czech Glass Crystal Beads- 9x12 mm</image:title>
      <image:caption>turquoise-faceted-glass-beads-5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/turquoise-faceted-glass-beads-6</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-19-48-41_product_1_1645625921901.jpg?v=1645625929</image:loc>
      <image:title>Turquoise Rondelle Faceted Czech Glass Crystal Beads- 9x12 mm</image:title>
      <image:caption>turquoise-faceted-glass-beads-6</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-faceted-glass-beads-3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-19-49-25_product_1_1645625965123.jpg?v=1645625972</image:loc>
      <image:title>Blue Rondelle Faceted Czech Glass Crystal Beads- 9x12 mm</image:title>
      <image:caption>blue-faceted-glass-beads-3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-faceted-glass-beads-3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-19-49-58_product_1_1645625998643.jpg?v=1645626006</image:loc>
      <image:title>Black Rondelle Faceted Czech Glass Crystal Beads- 9x12 mm</image:title>
      <image:caption>black-faceted-glass-beads-3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-faceted-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-19-50-34_product_1_1645626034478.jpg?v=1645626045</image:loc>
      <image:title>Peach Rondelle Faceted Czech Glass Crystal Beads- 9x12 mm</image:title>
      <image:caption>peach-faceted-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/topaz-faceted-glass-beads-5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-19-52-56_product_1_1645626176907.jpg?v=1645626184</image:loc>
      <image:title>Topaz Brown Rondelle Faceted Czech Glass Crystal Beads- 9x12 mm</image:title>
      <image:caption>topaz-faceted-glass-beads-5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/topaz-faceted-glass-beads-6</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-19-54-5_product_1_1645626245991.jpg?v=1645626253</image:loc>
      <image:title>Light Topaz Brown Rondelle Faceted Czech Glass Crystal Beads- 9x12 mm</image:title>
      <image:caption>topaz-faceted-glass-beads-6</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/turquoise-faceted-glass-beads-7</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-20-1-27_product_1_1645626687559.jpg?v=1645626695</image:loc>
      <image:title>Turquoise Rondelle Faceted Czech Glass Crystal Beads- 10x14 mm</image:title>
      <image:caption>turquoise-faceted-glass-beads-7</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/topaz-faceted-glass-beads-7</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-20-1-48_product_1_1645626708974.jpg?v=1645626715</image:loc>
      <image:title>Topaz Brown Rondelle Faceted Czech Glass Crystal Beads- 10x14 mm</image:title>
      <image:caption>topaz-faceted-glass-beads-7</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-faceted-glass-beads-4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-20-2-57_product_1_1645626777813.jpg?v=1645626786</image:loc>
      <image:title>Blue Rondelle Faceted Czech Glass Crystal Beads- 10x14 mm</image:title>
      <image:caption>blue-faceted-glass-beads-4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-blue-faceted-glass-beads-3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-20-3-38_product_1_1645626818098.jpg?v=1645626824</image:loc>
      <image:title>Light Blue Rondelle Faceted Czech Glass Crystal Beads- 10x14 mm</image:title>
      <image:caption>light-blue-faceted-glass-beads-3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-faceted-glass-beads-5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-20-7-32_product_1_1645627052350.jpg?v=1645627058</image:loc>
      <image:title>Blue Rondelle Faceted Czech Glass Crystal Beads- 14 mm</image:title>
      <image:caption>blue-faceted-glass-beads-5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/turquoise-faceted-glass-beads-8</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-20-44-18_product_1_1645629258175.jpg?v=1645629339</image:loc>
      <image:title>Turquoise Rondelle Faceted Czech Glass Crystal Beads- 14x18 mm</image:title>
      <image:caption>turquoise-faceted-glass-beads-8</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-blue-faceted-glass-beads-4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-20-44-24_product_1_1645629264926.jpg?v=1645629339</image:loc>
      <image:title>Light Blue Rondelle Faceted Czech Glass Crystal Beads- 14x18 mm</image:title>
      <image:caption>light-blue-faceted-glass-beads-4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-faceted-glass-beads-4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-20-44-29_product_1_1645629269563.jpg?v=1645629357</image:loc>
      <image:title>Black Rondelle Faceted Czech Glass Crystal Beads- 14x18 mm</image:title>
      <image:caption>black-faceted-glass-beads-4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/topaz-faceted-glass-beads-8</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-20-44-35_product_1_1645629275592.jpg?v=1645629362</image:loc>
      <image:title>Topaz Brown Rondelle Faceted Czech Glass Crystal Beads- 14x18 mm</image:title>
      <image:caption>topaz-faceted-glass-beads-8</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/purple-color-strawberry-shpae-button-for-kids-clothing-art-and-craft</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-22-35-36_product_1_1645635936035.jpg?v=1645635940</image:loc>
      <image:title>Purple Strawberry Wooden Button</image:title>
      <image:caption>purple-color-strawberry-shpae-button-for-kids-clothing-art-and-craft</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/apple-shaped-rani-color-wood-button-for-kids-clothing-art-and-craft-and-many-more</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-22-44-38_product_1_1645636478252.jpg?v=1645636481</image:loc>
      <image:title>Magenta Pink Apple 2 Hole Wooden Button</image:title>
      <image:caption>apple-shaped-rani-color-wood-button-for-kids-clothing-art-and-craft-and-many-more</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-color-apple-shaped-wooden-button-for-kids-clothing-art-and-craft-and-many-more</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-22-54-42_product_1_1645637082883.jpg?v=1645637087</image:loc>
      <image:title>Red Apple 2 Hole Wooden Button</image:title>
      <image:caption>red-color-apple-shaped-wooden-button-for-kids-clothing-art-and-craft-and-many-more</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-faceted-glass-beads-6</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-23-57-14_product_2_1645640834738.jpg?v=1645640847</image:loc>
      <image:title>Blue Faceted Rondelle Czech Glass Crystal Beads- 4 mm</image:title>
      <image:caption>blue-faceted-glass-beads-6</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/topaz-faceted-glass-beads-9</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-23-23-59-25_product_2_1645640965371.jpg?v=1645640975</image:loc>
      <image:title>Topaz Brown Faceted Rondelle Czech Glass Crystal Beads- 8 mm</image:title>
      <image:caption>topaz-faceted-glass-beads-9</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-faceted-glass-beads-7</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-24-0-0-57_product_2_1645641057841.jpg?v=1645641072</image:loc>
      <image:title>Blue Faceted Rondelle Czech Glass Crystal Beads- 10 mm</image:title>
      <image:caption>blue-faceted-glass-beads-7</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-blue-faceted-glass-beads-5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-24-0-2-19_product_2_1645641139476.jpg?v=1645641152</image:loc>
      <image:title>Light Blue Faceted Rondelle Czech Glass Crystal Beads- 12 mm</image:title>
      <image:caption>light-blue-faceted-glass-beads-5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-faceted-glass-beads-5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-24-0-4-12_product_2_1645641252705.jpg?v=1645641263</image:loc>
      <image:title>Black Faceted Rondelle Czech Glass Crystal Beads- 12 mm</image:title>
      <image:caption>black-faceted-glass-beads-5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/topaz-faceted-glass-beads-10</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-24-0-5-23_product_2_1645641323755.jpg?v=1645641341</image:loc>
      <image:title>Topaz Brown Faceted Rondelle Czech Glass Crystal Beads- 12 mm</image:title>
      <image:caption>topaz-faceted-glass-beads-10</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/topaz-faceted-glass-beads-11</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-24-0-6-36_product_2_1645641396688.jpg?v=1645641409</image:loc>
      <image:title>Topaz Brown Faceted Rondelle Czech Glass Crystal Beads- 14 mm</image:title>
      <image:caption>topaz-faceted-glass-beads-11</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-faceted-glass-beads-8</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-24-0-8-10_product_2_1645641490097.jpg?v=1645641500</image:loc>
      <image:title>Blue Faceted Rondelle Czech Glass Crystal Beads- 3 mm</image:title>
      <image:caption>blue-faceted-glass-beads-8</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/flower-shaped-rani-color-wooden-button-for-your-garments-art-and-craft-and-many-more</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-24-17-35-48_product_1_1645704348113.jpg?v=1645704358</image:loc>
      <image:title>Magenta Pink Flowers 2 Hole Wooden Button</image:title>
      <image:caption>flower-shaped-rani-color-wooden-button-for-your-garments-art-and-craft-and-many-more</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-color-with-white-base-wooden-two-hole-button-for-kids-garments-art-and-craft-and-many-more</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-24-22-3-19_product_1_1645720399416.jpg?v=1645720404</image:loc>
      <image:title>Green Designer 2 Hole Wooden Buttons</image:title>
      <image:caption>green-color-with-white-base-wooden-two-hole-button-for-kids-garments-art-and-craft-and-many-more</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/boy-shaped-cute-wooden-button-for-kids-garment-art-and-craft-and-many-more</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-25-18-47-48_product_1_1645795068897.jpg?v=1645795074</image:loc>
      <image:title>Multicolour Object Designer 2 Hole Wooden Button</image:title>
      <image:caption>boy-shaped-cute-wooden-button-for-kids-garment-art-and-craft-and-many-more</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/flower-shaped-wooden-button-with-side-hole-that-will-looks-beautiful-on-garments-art-and-craft-etc</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-25-19-1-55_product_1_1645795915461.jpg?v=1645795921</image:loc>
      <image:title>Multicolour Flower Designer Wooden Button</image:title>
      <image:caption>flower-shaped-wooden-button-with-side-hole-that-will-looks-beautiful-on-garments-art-and-craft-etc</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/rectangular-shape-wooden-button-for-kids-garment-art-and-craft-and-many-more</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-25-19-11-27_product_1_1645796487905.jpg?v=1645796495</image:loc>
      <image:title>Multicolour Designer Rectangular 2 Hole Wooden Buttons</image:title>
      <image:caption>rectangular-shape-wooden-button-for-kids-garment-art-and-craft-and-many-more</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/strawberry-shaped-wooden-buttons-for-kids-garment-art-and-craft-and-many-more</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-25-19-17-14_product_1_1645796834305.jpg?v=1645796840</image:loc>
      <image:title>Multicolour Strawberry Designer 2 Hole Wooden Button</image:title>
      <image:caption>strawberry-shaped-wooden-buttons-for-kids-garment-art-and-craft-and-many-more</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-clr-butterfly-shaped-wooden-button-for-kids-garments-art-and-craft-and-many-more</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-25-19-21-29_product_1_1645797089797.jpg?v=1645797094</image:loc>
      <image:title>Yellow Butterfly 2 Hole Wooden Buttons</image:title>
      <image:caption>yellow-clr-butterfly-shaped-wooden-button-for-kids-garments-art-and-craft-and-many-more</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-clr-bow-shaped-wooden-button-for-kids-garment-art-and-craft-and-many-more</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-25-19-25-15_product_1_1645797315247.jpg?v=1645797320</image:loc>
      <image:title>Green Designer Bow 2 Hole Wooden Buttons</image:title>
      <image:caption>green-clr-bow-shaped-wooden-button-for-kids-garment-art-and-craft-and-many-more</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-silverline-pipe-bugle-glass-seed-beads-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-26-1-25-20_product_1_1645818920050.jpg?v=1645818926</image:loc>
      <image:title>Golden Silverline Pipe / Bugle Glass Seed Beads</image:title>
      <image:caption>golden-silverline-pipe-bugle-glass-seed-beads-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silverline-golden-round-rocailles-seed-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-26-1-36-51_product_1_1645819611627.jpg?v=1645819618</image:loc>
      <image:title>Golden Silverline Round Rocaille Glass Seed Beads</image:title>
      <image:caption>silverline-golden-round-rocailles-seed-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/full-gold-pipe-bugle-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-26-2-0-18_product_1_1645821018999.jpg?v=1645821025</image:loc>
      <image:title>Dull Golden Pipe / Bugle Glass Seed Beads</image:title>
      <image:caption>full-gold-pipe-bugle-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/sage-green-with-lakhnawi-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-26-9-4-40_product_1_1645846480178.jpg?v=1645846526</image:loc>
      <image:title>Sage Green Flowers Lakhnawi Embroidered Chanderi Fabric</image:title>
      <image:caption>sage-green-with-lakhnawi-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-silver-mirror-work-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-26-9-10-35_product_1_1645846835937.jpg?v=1645846929</image:loc>
      <image:title>Green Silver Mirror Work Floral Embroidered Chanderi Fabric</image:title>
      <image:caption>green-silver-mirror-work-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/maroon-white-chikankari-embroidered-georgette</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-26-9-14-26_product_1_1645847066239.jpg?v=1645847087</image:loc>
      <image:title>Maroon White Flowers Chikankari Embroidered Georgette Fabric</image:title>
      <image:caption>maroon-white-chikankari-embroidered-georgette</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-inside-colour-seed-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-26-11-45-9_product_1_1645856109958.jpg?v=1645856118</image:loc>
      <image:title>Pink Inside Colour Round Rocaille Glass Seed Beads</image:title>
      <image:caption>pink-inside-colour-seed-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-round-glass-beads-6</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-27-10-31-4_product_1_1645938064705.jpg?v=1645938100</image:loc>
      <image:title>Blue Fancy Round Czech Glass Beads- 5 mm</image:title>
      <image:caption>fancy-round-glass-beads-6</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-round-glass-beads-7</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-27-10-55-4_product_1_1645939504965.jpg?v=1645939539</image:loc>
      <image:title>Blue Fancy Round Czech Glass Beads- 14 mm</image:title>
      <image:caption>fancy-round-glass-beads-7</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-round-glass-beads-8</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-27-10-55-12_product_1_1645939512526.jpg?v=1645939547</image:loc>
      <image:title>Light Blue Fancy Round Czech Glass Beads- 14 mm</image:title>
      <image:caption>fancy-round-glass-beads-8</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-tyre-glass-beads-3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-27-11-5-16_product_1_1645940116977.jpg?v=1645940151</image:loc>
      <image:title>Blue Fancy Tyre Czech Glass Beads- 8x11 mm</image:title>
      <image:caption>fancy-tyre-glass-beads-3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-round-glass-beads-13</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-27-11-43-8_product_1_1645942388559.jpg?v=1645942423</image:loc>
      <image:title>Blue Fancy Round Czech Glass Beads- 10 mm</image:title>
      <image:caption>fancy-round-glass-beads-13</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-drop-glass-bead</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-27-12-3-28_product_1_1645943608317.jpg?v=1645943642</image:loc>
      <image:title>Pastel Blue Fancy Drop Czech Glass Beads- 16x11 mm</image:title>
      <image:caption>fancy-drop-glass-bead</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-cylindrical-glass-bead</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-27-12-15-30_product_1_1645944330537.jpg?v=1645944365</image:loc>
      <image:title>Blue Fancy Cylindrical Czech Glass Beads- 15x8 mm</image:title>
      <image:caption>fancy-cylindrical-glass-bead</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-round-glass-beads-18</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-27-12-30-21_product_1_1645945221438.jpg?v=1645945255</image:loc>
      <image:title>Blue Fancy Round Czech Glass Beads- 10 mm</image:title>
      <image:caption>fancy-round-glass-beads-18</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-bicone-glass-beads-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-27-13-0-43_product_1_1645947043447.jpg?v=1645947077</image:loc>
      <image:title>Blue Fancy Bicone Czech Glass Beads- 7x7 mm</image:title>
      <image:caption>fancy-bicone-glass-beads-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-oval-glass-beads-7</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-27-13-4-40_product_1_1645947280064.jpg?v=1645947314</image:loc>
      <image:title>Blue Fancy Oval Czech Glass Beads- 7x14 mm</image:title>
      <image:caption>fancy-oval-glass-beads-7</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-oval-glass-beads-8</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-27-13-8-1_product_1_1645947481482.jpg?v=1645947515</image:loc>
      <image:title>Blue Fancy Oval Czech Glass Beads- 7x10 mm</image:title>
      <image:caption>fancy-oval-glass-beads-8</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-oval-glass-beads-9</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-27-13-11-27_product_1_1645947687977.jpg?v=1645947722</image:loc>
      <image:title>Blue Fancy Oval Czech Glass Beads- 9x12 mm</image:title>
      <image:caption>fancy-oval-glass-beads-9</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/beige-golden-embroidered-sequins-thread-motifs-chanderi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-1-12-4-30_product_1_1646116470690.jpg?v=1646116535</image:loc>
      <image:title>Beige Golden Floral Motifs Sequins Thread Embroidered Chanderi Fabric</image:title>
      <image:caption>beige-golden-embroidered-sequins-thread-motifs-chanderi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/turquoise-green-taffeta-silk-with-gold-sequins-rose-embroidered-motifs</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-1-12-9-23_product_1_1646116763532.jpg?v=1646116813</image:loc>
      <image:title>Turquoise Green Gold Sequins Floral Embroidered Motifs Taffeta Silk Fabric</image:title>
      <image:caption>turquoise-green-taffeta-silk-with-gold-sequins-rose-embroidered-motifs</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-green-embroidered-motifs-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-1-12-19-50_product_1_1646117390980.jpg?v=1646117446</image:loc>
      <image:title>Light Green Floral Embroidered Chanderi Fabric</image:title>
      <image:caption>light-green-embroidered-motifs-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-2-8-42-22_product_1_1646190742676.jpg?v=1646190762</image:loc>
      <image:title>Green Floral Motifs Embroidered Chanderi Fabric</image:title>
      <image:caption>green-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-green-chanderi-with-silver-mirror-work-embroidery-motifs</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-2-8-45-34_product_1_1646190934908.jpg?v=1646190955</image:loc>
      <image:title>Dark Green Silver Mirror Work Floral Motifs Embroidered Chanderi Fabric</image:title>
      <image:caption>dark-green-chanderi-with-silver-mirror-work-embroidery-motifs</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/orange-chanderi-with-silver-mirror-work-embroidery</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-2-8-49-15_product_1_1646191155309.jpg?v=1646191172</image:loc>
      <image:title>Orange Silver Mirror Work Floral Motifs Embroidered Chanderi Fabric</image:title>
      <image:caption>orange-chanderi-with-silver-mirror-work-embroidery</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-silver-mirror-work-embroidered-georgette</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-2-8-53-36_product_1_1646191416108.jpg?v=1664179923</image:loc>
      <image:title>Pink Silver faux Mirror Work Floral Motifs Embroidered Georgette Fabric</image:title>
      <image:caption>pink-silver-mirror-work-embroidered-georgette</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-pastel-georgette-sequins-thread-embroidered-patch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-4-9-38-35_product_1_1646366915373.jpg?v=1646366946</image:loc>
      <image:title>Pastel Yellow Sequins and Thread Embroidered Georgette Patch</image:title>
      <image:caption>yellow-pastel-georgette-sequins-thread-embroidered-patch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-round-glass-beads-15</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-4-12-30-45_product_1_1646377245197.jpg?v=1646377295</image:loc>
      <image:title>Yellow Fancy Round Czech Glass Beads- 8x8 mm</image:title>
      <image:caption>fancy-round-glass-beads-15</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-cylindrical-glass</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-4-12-37-16_product_1_1646377636001.jpg?v=1646377679</image:loc>
      <image:title>Yellow Fancy Cylindrical Czech Glass Beads - 11x8 mm</image:title>
      <image:caption>fancy-cylindrical-glass</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-cylindrical-glass-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-4-12-37-16_product_1_1646377636425.jpg?v=1646377679</image:loc>
      <image:title>Yellow Fancy Cylindrical Czech Glass Beads - 11x8 mm</image:title>
      <image:caption>fancy-cylindrical-glass-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-cylinderical-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-4-13-5-43_product_1_1646379343781.jpg?v=1646379386</image:loc>
      <image:title>Yellow Fancy Cylindrical Czech Glass Beads- 8x8 mm</image:title>
      <image:caption>fancy-cylinderical-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-button-glass-beads-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-4-13-13-44_product_1_1646379824054.jpg?v=1646379867</image:loc>
      <image:title>Red Fancy Flat Circular Czech Glass Beads- 2x5 mm</image:title>
      <image:caption>fancy-button-glass-beads-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-cylinderical-glass-beads-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-4-13-22-14_product_1_1646380334376.jpg?v=1646380378</image:loc>
      <image:title>Red Fancy Cylindrical Czech Glass Beads- 5x8 mm</image:title>
      <image:caption>fancy-cylinderical-glass-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-round-glass-bead</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-4-13-27-33_product_1_1646380653680.jpg?v=1646380702</image:loc>
      <image:title>Red Fancy Round Czech Glass Beads- 6 mm</image:title>
      <image:caption>fancy-round-glass-bead</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-oval-glass-beads-11</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-4-13-32-19_product_1_1646380939491.jpg?v=1646380981</image:loc>
      <image:title>Red Fancy Oval Czech Glass Beads- 6x9 mm</image:title>
      <image:caption>fancy-oval-glass-beads-11</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-oval-glass-beads-13</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-4-13-55-59_product_1_1646382359606.jpg?v=1646382401</image:loc>
      <image:title>Maroon Fancy Oval Czech Glass Beads- 4x6 mm</image:title>
      <image:caption>fancy-oval-glass-beads-13</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-round-glass-beads-19</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-4-14-1-51_product_1_1646382711082.jpg?v=1646382754</image:loc>
      <image:title>Orange Fancy Round Czech Glass Beads- 8 mm</image:title>
      <image:caption>fancy-round-glass-beads-19</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-round-glass-bead-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-4-14-48-32_product_1_1646385512791.jpg?v=1646385556</image:loc>
      <image:title>Yellow Fancy Round Glass Beads- 6 mm</image:title>
      <image:caption>fancy-round-glass-bead-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-round-glass-beads-22</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-4-15-9-0_product_1_1646386740870.jpg?v=1646386784</image:loc>
      <image:title>Yellow Fancy Round Czech Glass Beads- 8 mm</image:title>
      <image:caption>fancy-round-glass-beads-22</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-oval-glass-beads-17</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-4-15-34-32_product_1_1646388272707.jpg?v=1646388316</image:loc>
      <image:title>Pink Transparent Fancy Oval Czech Glass Beads- 7x11 mm</image:title>
      <image:caption>fancy-oval-glass-beads-17</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-round-glass-beads-24</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-4-15-49-11_product_1_1646389151507.jpg?v=1646389195</image:loc>
      <image:title>Baby Pink Fancy Round Czech Glass Beads- 6 mm</image:title>
      <image:caption>fancy-round-glass-beads-24</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-round-glass-beads-25</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-4-15-49-36_product_1_1646389176056.jpg?v=1646389219</image:loc>
      <image:title>Light Pink Fancy Round Czech Glass Beads- 6 mm</image:title>
      <image:caption>fancy-round-glass-beads-25</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-round-glass-beads-26</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-4-15-58-35_product_1_1646389715260.jpg?v=1646389757</image:loc>
      <image:title>Pink Fancy Round Czech Glass Beads- 10 mm</image:title>
      <image:caption>fancy-round-glass-beads-26</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-cylindrical-glass-beads-7</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-4-17-1-19_product_1_1646393479212.jpg?v=1646393520</image:loc>
      <image:title>Pink Fancy Cylindrical Czech Glass Beads- 8x6 mm</image:title>
      <image:caption>fancy-cylindrical-glass-beads-7</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/off-white-geometric-sequins-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-7-10-5-21_product_1_1646627721908.jpg?v=1646627816</image:loc>
      <image:title>Off White Geometric Sequins Embroidered Chanderi Fabric</image:title>
      <image:caption>off-white-geometric-sequins-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-geometric-design-sequins-embroidered-chanderi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-7-10-10-14_product_1_1646628014797.jpg?v=1646628130</image:loc>
      <image:title>Green Geometric Sequins Embroidered Chanderi Fabric</image:title>
      <image:caption>green-geometric-design-sequins-embroidered-chanderi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-dori-jaal-embroidered-net-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-7-10-13-51_product_1_1646628231095.jpg?v=1646628273</image:loc>
      <image:title>Silver Flowers Dori Jaal Embroidered Net Fabric</image:title>
      <image:caption>silver-dori-jaal-embroidered-net-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-georgette-sequins-thread-embroidered-patch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-7-10-18-59_product_1_1646628539996.jpg?v=1646628552</image:loc>
      <image:title>Green Sequins and Thread Embroidered Georgette Patch</image:title>
      <image:caption>green-georgette-sequins-thread-embroidered-patch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-shell-flat-plastic-sequins-12-mm-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Golden_Shell_Flat_Plastic_Sequins-_12_mm__product_1_1614595191975_a7e67822-545e-4a9f-b2ab-2e3d1c9ecfe6.jpg?v=1646637614</image:loc>
      <image:title>Golden Shell Flat Plastic Sequins- 12 mm</image:title>
      <image:caption>golden-shell-flat-plastic-sequins-12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-beaded-laces</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-7-18-20-12_product_1_1646657412537.jpg?v=1646657419</image:loc>
      <image:title>Golden Fancy Beaded Laces</image:title>
      <image:caption>golden-beaded-laces</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-yellow-beaded-laces</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-7-18-25-15_product_1_1646657715359.jpg?v=1646657721</image:loc>
      <image:title>Golden Yellow Designer Beaded Laces</image:title>
      <image:caption>golden-yellow-beaded-laces</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/swarovski-cream-spherical-glass-pearl</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-7-18-33-36_product_1_1646658216904.jpg?v=1646658224</image:loc>
      <image:title>Cream Premium Quality Spherical Glass Pearl</image:title>
      <image:caption>swarovski-cream-spherical-glass-pearl</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-chanderi-with-dori-embroidered-jaal-allover</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-8-10-19-57_product_1_1646714997706.jpg?v=1646715015</image:loc>
      <image:title>Yellow Flowers Dori Embroidered Chanderi Fabric</image:title>
      <image:caption>yellow-chanderi-with-dori-embroidered-jaal-allover</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-white-chikankari-embroidered-chanderi-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-8-10-31-54_product_1_1646715714173.jpg?v=1646715819</image:loc>
      <image:title>Pink White Flowers Chikankari Embroidered Chanderi Fabric</image:title>
      <image:caption>pink-white-chikankari-embroidered-chanderi-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/bottle-green-white-chikankari-embroidered-georgette</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-8-10-38-55_product_1_1646716135314.jpg?v=1646716160</image:loc>
      <image:title>Bottle Green White Flowers Chikankari Embroidered Georgette Fabric</image:title>
      <image:caption>bottle-green-white-chikankari-embroidered-georgette</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-oval-glass-beads-18</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-8-17-27-36_product_1_1646740656843.jpg?v=1646740705</image:loc>
      <image:title>Yellow Fancy Oval Czech Glass Beads - 8 mm</image:title>
      <image:caption>fancy-oval-glass-beads-18</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-diamond-shape-glass</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-8-17-31-29_product_2_1646740889596.jpg?v=1646740943</image:loc>
      <image:title>Red Fancy Diamond Czech Glass Beads - 12x18 mm</image:title>
      <image:caption>fancy-diamond-shape-glass</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-oval-glass-beads-19</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-8-17-40-29_product_1_1646741429337.jpg?v=1646741478</image:loc>
      <image:title>Yellow Fancy Oval Czech Glass Beads- 9x4 mm</image:title>
      <image:caption>fancy-oval-glass-beads-19</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-oval-glass-bead</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-8-17-44-36_product_1_1646741676726.jpg?v=1646741731</image:loc>
      <image:title>Red Fancy Oval Czech Glass Beads- 5x7 mm</image:title>
      <image:caption>fancy-oval-glass-bead</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-oval-glass-beads-20</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-8-17-47-15_product_1_1646741835601.jpg?v=1646741883</image:loc>
      <image:title>Orange Fancy Oval Czech Glass Beads- 5x7 mm</image:title>
      <image:caption>fancy-oval-glass-beads-20</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-round-glass-beads-29</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-8-17-55-8_product_1_1646742308717.jpg?v=1646742357</image:loc>
      <image:title>Yellow Fancy Round Czech Glass Beads- 5 mm</image:title>
      <image:caption>fancy-round-glass-beads-29</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-oval-glass-beads-21</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-8-18-9-12_product_1_1646743152227.jpg?v=1646743202</image:loc>
      <image:title>Blue Fancy Oval Czech Glass Beads- 6x8 mm</image:title>
      <image:caption>fancy-oval-glass-beads-21</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-round-glass-beads-30</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-8-18-11-41_product_1_1646743301542.jpg?v=1646743349</image:loc>
      <image:title>White Gold Fancy Round Czech Glass Beads- 6 mm</image:title>
      <image:caption>fancy-round-glass-beads-30</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-plated-brass-wire-18-gauge</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-19-17-34-3_product_1_1642593843184_52acb1ac-ac91-4819-96cb-7466c8c21247.jpg?v=1745224912</image:loc>
      <image:title>Silver Plated Brass Wire- 18 Gauge</image:title>
      <image:caption>silver-plated-brass-wire-18-gauge-bwire-015-sold-by-pre-roll-of-100-gram</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-plated-brass-wire-16-gauge</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-19-13-39-8_product_1_1642579748920_e4f37593-628e-4f3d-8be5-e09b58163f15.jpg?v=1745222755</image:loc>
      <image:title>Golden Plated Brass Wire- 16 Gauge</image:title>
      <image:caption>gold-plated-brass-wire-16-gauge-bwire-008-sold-by-pre-roll-of-100-gram</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-plated-brass-wire-18-gauge</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-19-13-25-18_product_1_1642578918024_bdfe6454-e974-4dae-b464-dda41ab05668.jpg?v=1745222757</image:loc>
      <image:title>Golden Plated Brass Wire- 18 Gauge</image:title>
      <image:caption>gold-plated-brass-wire-18-gauge-bwire-007-sold-by-pre-roll-of-100-gram</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-plated-brass-wire-20-gauge</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-1-19-13-20-22_product_1_1642578622308_8b6686b5-95e9-483e-b2cb-cca2598de217.jpg?v=1745222759</image:loc>
      <image:title>Golden Plated Brass Wire- 20 Gauge</image:title>
      <image:caption>gold-plated-brass-wire-20-gauge-bwire-006-sold-by-pre-roll-of-100-gram</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-dori-thread-embroidered-taffeta-silk</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-10-10-55-43_product_1_1646889943800.jpg?v=1646889982</image:loc>
      <image:title>Golden Floral Dori &amp; Thread Embroidered Taffeta Silk Fabric</image:title>
      <image:caption>golden-dori-thread-embroidered-taffeta-silk</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-white-heavy-embroidered-lakhnawi-georgette-with-border</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-11-9-44-24_product_1_1646972064817.jpg?v=1646972103</image:loc>
      <image:title>Black White Heavy Embroidered Lakhnawi Georgette Fabric with Border</image:title>
      <image:caption>black-white-heavy-embroidered-lakhnawi-georgette-with-border</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/mint-green-sequins-embroidered-imported-satin-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-11-9-48-10_product_1_1646972290562.jpg?v=1646972307</image:loc>
      <image:title>Mint Green Floral Sequins Embroidered Imported Satin Fabric</image:title>
      <image:caption>mint-green-sequins-embroidered-imported-satin-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/beige-chanderi-with-multicolored-mirror-work-heavy-embroidery</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-11-9-52-26_product_1_1646972546709.jpg?v=1646972622</image:loc>
      <image:title>Beige Multicolour Mirror Work Floral Heavy Embroidered Chanderi Fabric</image:title>
      <image:caption>beige-chanderi-with-multicolored-mirror-work-heavy-embroidery</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/mustard-maroon-stripes-printed-pure-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-12-17-26-58_product_1_1647086218949.jpg?v=1754479562</image:loc>
      <image:title>Maroon Mustard Stripes Printed Pure Cotton Fabric</image:title>
      <image:caption>mustard-maroon-stripes-printed-pure-cotton-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-turquoise-floral-printed-pure-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/10017b.png?v=1772798738</image:loc>
      <image:title>Blue &amp; Turquoise Floral Printed Pure Cotton Fabric</image:title>
      <image:caption>blue-turquoise-floral-printed-pure-cotton-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/navy-blue-georgette-with-white-lakhnawi-flower-motifs</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-13-9-5-42_product_1_1647142542188.jpg?v=1647142551</image:loc>
      <image:title>Navy Blue White Lakhnawi Flower Motifs Embroidered Georgette Fabric</image:title>
      <image:caption>navy-blue-georgette-with-white-lakhnawi-flower-motifs</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-chikankari-gota-patti-embroidered-chanderi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-13-9-9-58_product_1_1647142798341.jpg?v=1647142815</image:loc>
      <image:title>Pink White Floral Gota Patti Chikankari Embroidered Chanderi Fabric</image:title>
      <image:caption>pink-chikankari-gota-patti-embroidered-chanderi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-mushroom-shaped-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-14-15-8-32_product_1_1647250712971.jpg?v=1647250723</image:loc>
      <image:title>Blue Mushroom Glass Beads- 30 mm</image:title>
      <image:caption>blue-mushroom-shaped-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/brown-mushroom-shaped-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-14-15-11-13_product_1_1647250873426.jpg?v=1647250883</image:loc>
      <image:title>Brown Mushroom Glass Beads- 30 mm</image:title>
      <image:caption>brown-mushroom-shaped-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/mushroom-shaped-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-14-15-17-29_product_1_1647251249629.jpg?v=1647251259</image:loc>
      <image:title>Multicolour Mushroom Glass Beads- 30 mm</image:title>
      <image:caption>mushroom-shaped-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/mushroom-shaped-glass-beads-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-14-15-25-36_product_1_1647251736360.jpg?v=1647251746</image:loc>
      <image:title>Yellow Mushroom Glass Beads- 30 mm</image:title>
      <image:caption>mushroom-shaped-glass-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-mushroom-shaped-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-14-15-27-59_product_1_1647251879677.jpg?v=1647251890</image:loc>
      <image:title>Green Mushroom Glass Beads- 30 mm</image:title>
      <image:caption>green-mushroom-shaped-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-14-17-25-38_product_1_1647258938773.jpg?v=1647258997</image:loc>
      <image:title>Dark Blue Circular Fancy Czech Glass Beads - 8 mm</image:title>
      <image:caption>fancy-glass-beads-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-6</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-14-17-42-47_product_1_1647259967700.jpg?v=1647260025</image:loc>
      <image:title>Orange Designer Oval Czech Glass Beads - 10x10 mm</image:title>
      <image:caption>fancy-glass-beads-6</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-7</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-14-17-45-22_product_1_1647260122096.jpg?v=1647260180</image:loc>
      <image:title>Orange Fancy Circular Czech Glass Beads - 10x10 mm</image:title>
      <image:caption>fancy-glass-beads-7</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-8</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-14-17-52-42_product_1_1647260562609.jpg?v=1647260619</image:loc>
      <image:title>Orange Fancy Circular Czech Glass Beads - 12 mm</image:title>
      <image:caption>fancy-glass-beads-8</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-10</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-14-17-55-48_product_1_1647260748104.jpg?v=1647260805</image:loc>
      <image:title>Blue Fancy Oval Czech Glass Beads - 12x18 mm</image:title>
      <image:caption>fancy-glass-beads-10</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-14</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-14-18-28-1_product_1_1647262681684.jpg?v=1647262740</image:loc>
      <image:title>Light Blue Oval Designer Czech Glass Beads - 10x13 mm</image:title>
      <image:caption>fancy-glass-beads-14</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-17</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-14-18-46-10_product_1_1647263770423.jpg?v=1647263828</image:loc>
      <image:title>Sky Blue Designer Circular Czech Glass Beads - 14 mm</image:title>
      <image:caption>fancy-glass-beads-17</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/olive-yellow-chevron-printed-pure-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-9-58-10_product_1_1647318490942.jpg?v=1647318497</image:loc>
      <image:title>Olive Green Yellow Chevron Printed Pure Cotton Fabric</image:title>
      <image:caption>olive-yellow-chevron-printed-pure-cotton-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-white-floral-printed-pure-cotton-fabric-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-10-0-36_product_1_1647318636454.jpg?v=1754049917</image:loc>
      <image:title>Pink White Floral Printed Pure Cotton Fabric</image:title>
      <image:caption>pink-white-floral-printed-pure-cotton-fabric-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/sea-blue-multicolored-cross-stitch-chanderi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-9-58-39_product_1_1647318519261.jpg?v=1647318645</image:loc>
      <image:title>Sea Blue Multicolour Cross Stitch Flowers Embroidered Chanderi Fabric</image:title>
      <image:caption>sea-blue-multicolored-cross-stitch-chanderi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-multicolored-cross-stitch-embroidered-chanderi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-10-3-25_product_1_1647318805194.jpg?v=1647318820</image:loc>
      <image:title>Pink Multicolour Cross Stitch Flowers Embroidered Chanderi Fabric</image:title>
      <image:caption>pink-multicolored-cross-stitch-embroidered-chanderi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/bright-pink-sequins-zari-embroidered-georgette</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-10-10-42_product_1_1647319242292.jpg?v=1647319270</image:loc>
      <image:title>Bright Pink Sequins and Zari Floral Motifs Embroidered Georgette Fabric</image:title>
      <image:caption>bright-pink-sequins-zari-embroidered-georgette</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-georgette-with-white-chikankari-flowers-allover</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-10-13-9_product_1_1647319389748.jpg?v=1647319405</image:loc>
      <image:title>Peach White Chikankari Flowers Embroidered Georgette Fabric</image:title>
      <image:caption>peach-georgette-with-white-chikankari-flowers-allover</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-oval-glass-beads-22</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-10-23-37_product_1_1647320017192.jpg?v=1647320079</image:loc>
      <image:title>Black Fancy Oval Czech Glass Beads- 9x11 mm</image:title>
      <image:caption>fancy-oval-glass-beads-22</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-22</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-10-29-56_product_1_1647320396870.jpg?v=1647320463</image:loc>
      <image:title>Light Pink Fancy Czech Glass Beads - 6 mm</image:title>
      <image:caption>fancy-glass-beads-22</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-23</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-10-39-53_product_1_1647320993104.jpg?v=1647321055</image:loc>
      <image:title>Baby Pink Circular Designer Czech Glass Beads - 12 mm</image:title>
      <image:caption>fancy-glass-beads-23</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-24</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-11-36-19_product_1_1647324379152.jpg?v=1647324441</image:loc>
      <image:title>Black Cylindrical Fancy Czech Glass Beads - 14x20 mm</image:title>
      <image:caption>fancy-glass-beads-24</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-26</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-11-46-38_product_1_1647324998793.jpg?v=1647325061</image:loc>
      <image:title>Light Blue Fancy Oval Czech Glass Beads - 10x13 mm</image:title>
      <image:caption>fancy-glass-beads-26</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-29</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-12-30-24_product_1_1647327624615.jpg?v=1647327687</image:loc>
      <image:title>Brown Designer Oval Czech Glass Beads - 10x13 mm</image:title>
      <image:caption>fancy-glass-beads-29</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-30</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-14-3-1_product_1_1647333181117.jpg?v=1647333242</image:loc>
      <image:title>Sky Blue Circular Czech Glass Beads - 10 mm</image:title>
      <image:caption>fancy-glass-beads-30</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-32</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-14-8-55_product_1_1647333535422.jpg?v=1647333596</image:loc>
      <image:title>Red Gray Oval Fancy Czech Glass Beads - 9x11 mm</image:title>
      <image:caption>fancy-glass-beads-32</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-33</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-14-12-4_product_1_1647333724703.jpg?v=1647333787</image:loc>
      <image:title>Dark Red Circular Fancy Czech Glass Beads - 12 mm</image:title>
      <image:caption>fancy-glass-beads-33</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-36</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-14-24-59_product_1_1647334499119.jpg?v=1647334559</image:loc>
      <image:title>Red Fancy Designer Czech Glass Beads - 12x18 mm</image:title>
      <image:caption>fancy-glass-beads-36</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-37</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-14-27-32_product_1_1647334652077.jpg?v=1647334714</image:loc>
      <image:title>Sky Blue Fancy Czech Glass Beads - 12 mm</image:title>
      <image:caption>fancy-glass-beads-37</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-38</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-14-45-24_product_1_1647335724663.jpg?v=1647335786</image:loc>
      <image:title>Black Gold Designer Circular Czech Glass Beads - 14 mm</image:title>
      <image:caption>fancy-glass-beads-38</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-39</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-14-50-37_product_1_1647336037314.jpg?v=1647336098</image:loc>
      <image:title>White Pink Fancy Circular Czech Glass Beads- 8 mm</image:title>
      <image:caption>fancy-glass-beads-39</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-41</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-15-19-21_product_1_1647337761917.jpg?v=1647337822</image:loc>
      <image:title>Light Blue Drop Czech Glass Beads - 23x9 mm</image:title>
      <image:caption>fancy-glass-beads-41</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-42</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-15-31-22_product_1_1647338482529.jpg?v=1647338543</image:loc>
      <image:title>Light Green Circular Fancy Czech Glass Beads - 10 mm</image:title>
      <image:caption>fancy-glass-beads-42</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-43</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-15-44-15_product_1_1647339255568.jpg?v=1647339317</image:loc>
      <image:title>Light Sky Blue Circular Fancy Czech Glass Beads - 12 mm</image:title>
      <image:caption>fancy-glass-beads-43</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-45</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-16-0-11_product_1_1647340211563.jpg?v=1647340272</image:loc>
      <image:title>Light Gray Fancy Oval Czech Glass Beads - 10x13 mm</image:title>
      <image:caption>fancy-glass-beads-45</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-46</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-16-5-55_product_1_1647340555097.jpg?v=1647340617</image:loc>
      <image:title>Dark Blue Fancy Czech Glass Beads- 10 mm</image:title>
      <image:caption>fancy-glass-beads-46</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-47</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-16-9-13_product_1_1647340753820.jpg?v=1647340815</image:loc>
      <image:title>Light Blue Circular Czech Glass Beads - 14 mm</image:title>
      <image:caption>fancy-glass-beads-47</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-48</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-16-12-42_product_1_1647340962106.jpg?v=1647341023</image:loc>
      <image:title>Multicolour Cylindrical Designer Czech Glass Beads - 10x20 mm</image:title>
      <image:caption>fancy-glass-beads-48</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-49</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-16-54-14_product_1_1647343454049.jpg?v=1647343514</image:loc>
      <image:title>Purple Multicolour Flat Circular Czech Glass Beads - 20 mm</image:title>
      <image:caption>fancy-glass-beads-49</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-50</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-16-57-55_product_1_1647343675930.jpg?v=1647343736</image:loc>
      <image:title>Light Blue Flat Circular Czech Glass Beads - 16 mm</image:title>
      <image:caption>fancy-glass-beads-50</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-53</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-17-5-36_product_1_1647344136665.jpg?v=1647344197</image:loc>
      <image:title>Mehendi Green Drop Czech Glass Beads - 12x18 mm</image:title>
      <image:caption>fancy-glass-beads-53</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/orange-designer-oval-glass-beads-12x16-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-17-11-43_product_1_1647344503135.jpg?v=1647344509</image:loc>
      <image:title>Orange Designer Oval Glass Beads- 12x16 mm</image:title>
      <image:caption>orange-designer-oval-glass-beads-12x16-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-54</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-17-11-9_product_1_1647344469914.jpg?v=1647344530</image:loc>
      <image:title>White Black Dots Cylindrical Czech Glass Beads - 12x16 mm</image:title>
      <image:caption>fancy-glass-beads-54</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-55</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-17-13-43_product_1_1647344623731.jpg?v=1647344684</image:loc>
      <image:title>White Red Circular Czech Glass Beads - 17 mm</image:title>
      <image:caption>fancy-glass-beads-55</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-56</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-17-16-41_product_1_1647344801364.jpg?v=1647344863</image:loc>
      <image:title>Blue Drop Designer Czech Glass Beads - 12x18 mm</image:title>
      <image:caption>fancy-glass-beads-56</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-59</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-17-37-48_product_1_1647346068635.jpg?v=1647346129</image:loc>
      <image:title>Light Blue Designer Drop Czech Glass Beads - 11x19 mm</image:title>
      <image:caption>fancy-glass-beads-59</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-60</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-17-44-15_product_1_1647346455102.jpg?v=1647346515</image:loc>
      <image:title>Light Purple Flat Circular Czech Glass Beads - 10x14 mm</image:title>
      <image:caption>fancy-glass-beads-60</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-circular-pressed-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-17-46-6_product_1_1647346566684.jpg?v=1647346574</image:loc>
      <image:title>Green Circular Pressed Glass Beads</image:title>
      <image:caption>green-circular-pressed-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/deep-red-circular-pressed-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-17-49-22_product_1_1647346762609.jpg?v=1647346769</image:loc>
      <image:title>Deep Red Circular Pressed Glass Beads</image:title>
      <image:caption>deep-red-circular-pressed-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-square-pressed-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-17-55-24_product_1_1647347124125.jpg?v=1647347130</image:loc>
      <image:title>Green Square Pressed Glass Beads- 8 mm</image:title>
      <image:caption>green-square-pressed-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/orange-designer-spherical-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-18-0-57_product_1_1647347457615.jpg?v=1647347464</image:loc>
      <image:title>Orange Black Designer Spherical Glass Beads- 8 mm</image:title>
      <image:caption>orange-designer-spherical-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-tear-drop-designer-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-18-7-33_product_1_1647347853676.jpg?v=1647347861</image:loc>
      <image:title>Red Golden Tear Drop Designer Glass Beads- 4x6 mm</image:title>
      <image:caption>red-tear-drop-designer-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-tear-drop-designer-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-18-9-48_product_1_1647347988867.jpg?v=1647347996</image:loc>
      <image:title>Green Golden Tear Drop Designer Glass Beads- 4x6 mm</image:title>
      <image:caption>green-tear-drop-designer-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/teal-green-tear-drop-designer-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-18-15-23_product_1_1647348323254.jpg?v=1647348329</image:loc>
      <image:title>Teal Green Golden Tear Drop Designer Glass Beads- 4x6 mm</image:title>
      <image:caption>teal-green-tear-drop-designer-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-62</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-18-15-0_product_1_1647348300434.jpg?v=1647348360</image:loc>
      <image:title>Light Gray Fancy Cuboidal Czech Glass Beads - 12x10 mm</image:title>
      <image:caption>fancy-glass-beads-62</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-63</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-18-17-13_product_1_1647348433091.jpg?v=1647348492</image:loc>
      <image:title>White Designer Cuboidal Czech Glass Beads - 10x10 mm</image:title>
      <image:caption>fancy-glass-beads-63</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-tear-drop-designer-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-18-18-14_product_1_1647348494541.jpg?v=1647348501</image:loc>
      <image:title>White Golden Tear Drop Designer Glass Beads- 4x6 mm</image:title>
      <image:caption>white-tear-drop-designer-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-67</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-18-30-54_product_1_1647349254017.jpg?v=1647349314</image:loc>
      <image:title>Dark Brown Flat Circular Czech Glass Beads - 20 mm</image:title>
      <image:caption>fancy-glass-beads-67</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-69</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-18-37-38_product_1_1647349658265.jpg?v=1647349719</image:loc>
      <image:title>Light Gray Cuboidal Fancy Czech Glass Beads - 12x12 mm</image:title>
      <image:caption>fancy-glass-beads-69</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-bead-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-18-43-5_product_1_1647349985618.jpg?v=1647350046</image:loc>
      <image:title>Light Gray Cylindrical Fancy Czech Glass Beads - 14x27 mm</image:title>
      <image:caption>fancy-glass-bead-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-70</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-15-18-45-45_product_1_1647350145919.jpg?v=1647350206</image:loc>
      <image:title>Maroon Drop Fancy Czech Glass Beads - 12x20 mm</image:title>
      <image:caption>fancy-glass-beads-70</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/square12stoneplasticbuttons01</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/deac0d6c5e3c1dca8c7b4d723a7be586.jpg?v=1647351017</image:loc>
      <image:title>Blue Flower Stone Plastic Buttons</image:title>
      <image:caption>square12stoneplasticbuttons01</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/square12stoneplasticbuttons03</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a3d93b52d804c3a02924a3e7a4df61ee.jpg?v=1647351094</image:loc>
      <image:title>Bright Blue Flower Stone Plastic Buttons</image:title>
      <image:caption>square12stoneplasticbuttons03</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/square12stoneplasticbuttons05</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/e6ed6d56f8cc559e0552cdad0a08ddc0.jpg?v=1647351175</image:loc>
      <image:title>Pink Flower Stone Plastic Buttons</image:title>
      <image:caption>square12stoneplasticbuttons05</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/square12stoneplasticbuttons06</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/61383fbb46b67e246b0748e1fda20ef0.jpg?v=1647351214</image:loc>
      <image:title>Orange Flower Stone Plastic Buttons</image:title>
      <image:caption>square12stoneplasticbuttons06</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/square12stoneplasticbuttons07</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/59414945c18a38d385004b2ad9fbf6f4.jpg?v=1647351254</image:loc>
      <image:title>Yellow Flower Stone Plastic Buttons</image:title>
      <image:caption>square12stoneplasticbuttons07</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/square12stoneplasticbuttons08</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/57506bf2eabcbcd68d1f861a3527e65d.jpg?v=1647351322</image:loc>
      <image:title>Brown Flower Stone Plastic Buttons</image:title>
      <image:caption>square12stoneplasticbuttons08</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/square12stoneplasticbuttons09</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/92b36752bad14f2c555b323a33e1f673.jpg?v=1647351358</image:loc>
      <image:title>Peach Flower Stone Plastic Buttons</image:title>
      <image:caption>square12stoneplasticbuttons09</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/square12stoneplasticbuttons12</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/25f49e4a53b3b45ab96ad50efc2e8ec2.jpg?v=1647351467</image:loc>
      <image:title>Sea Green Square Stone Plastic Buttons</image:title>
      <image:caption>square12stoneplasticbuttons12</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/square12stoneplasticbuttons13</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/78ef75a6d0e0172cb29b00818cbdfc84.jpg?v=1647351502</image:loc>
      <image:title>Light Yellow Square Stone Plastic Buttons</image:title>
      <image:caption>square12stoneplasticbuttons13</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/square12stoneplasticbuttons14</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/928a22a3b99b79c20bd9106a7f13dad0.jpg?v=1647351539</image:loc>
      <image:title>Deep Yellow Square Stone Plastic Buttons</image:title>
      <image:caption>square12stoneplasticbuttons14</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/square12stoneplasticbuttons15</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1063f26862ad339b9c1f94b6a06cd300.jpg?v=1647351603</image:loc>
      <image:title>White Square Stone Plastic Buttons</image:title>
      <image:caption>square12stoneplasticbuttons15</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/square12stoneplasticbuttons16</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/67781a134a86f080549244d624d99685.jpg?v=1647351640</image:loc>
      <image:title>Green Square Stone Plastic Buttons</image:title>
      <image:caption>square12stoneplasticbuttons16</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/square12stoneplasticbuttons17</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c7945decbc35129cbf2855e62a390f53.jpg?v=1647351677</image:loc>
      <image:title>Pink Square Stone Plastic Buttons</image:title>
      <image:caption>square12stoneplasticbuttons17</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/square12stoneplasticbuttons18</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d879607d988a1650341c066becbd5a9d.jpg?v=1647351714</image:loc>
      <image:title>Peach Square Stone Plastic Buttons</image:title>
      <image:caption>square12stoneplasticbuttons18</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/square12stoneplasticbuttons19</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/875627d0d6ca92297b442eccb4940b4d.jpg?v=1647351744</image:loc>
      <image:title>Orange Square Stone Plastic Buttons</image:title>
      <image:caption>square12stoneplasticbuttons19</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/square12stoneplasticbuttons20</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6c77461bc0b58cc59efb0e239c4d4a14.jpg?v=1647351778</image:loc>
      <image:title>Yellow Square Stone Plastic Buttons</image:title>
      <image:caption>square12stoneplasticbuttons20</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/square12stoneplasticbuttons21</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/808d85cc5bbfff5d4e5bfff9a2ae44c7.jpg?v=1647351843</image:loc>
      <image:title>Black Square Stone Plastic Buttons</image:title>
      <image:caption>square12stoneplasticbuttons21</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-71</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-16-10-36-19_product_1_1647407179256.jpg?v=1647407243</image:loc>
      <image:title>Orange Pink Cylindrical Czech Glass Beads - 10x15 mm</image:title>
      <image:caption>fancy-glass-beads-71</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-72</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-16-10-41-54_product_1_1647407514331.jpg?v=1647407575</image:loc>
      <image:title>Black Multicolour Designer Czech Glass Beads - 20 mm</image:title>
      <image:caption>fancy-glass-beads-72</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-73</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-16-11-29-51_product_1_1647410391813.jpg?v=1647410457</image:loc>
      <image:title>Light Blue Designer Czech Glass Beads- 14x18 mm</image:title>
      <image:caption>fancy-glass-beads-73</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-74</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-16-14-0-7_product_1_1647419407737.jpg?v=1647419469</image:loc>
      <image:title>Yellow Flat Circular Fancy Czech Glass Beads - 6 mm</image:title>
      <image:caption>fancy-glass-beads-74</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-75</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-16-14-4-6_product_1_1647419646361.jpg?v=1647419709</image:loc>
      <image:title>Red Circular Czech Glass Beads - 6 mm</image:title>
      <image:caption>fancy-glass-beads-75</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-77</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-16-14-9-4_product_1_1647419944226.jpg?v=1647420005</image:loc>
      <image:title>Yellow Flat Circular Czech Glass Beads - 5 mm</image:title>
      <image:caption>fancy-glass-beads-77</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-81</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-16-14-26-9_product_1_1647420969392.jpg?v=1647421030</image:loc>
      <image:title>Light Blue Cuboidal Czech Glass Beads - 5x7 mm</image:title>
      <image:caption>fancy-glass-beads-81</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/designer-acrylic-chains</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-16-16-41-23_product_1_1647429083537.jpg?v=1647429089</image:loc>
      <image:title>Cream Beige Designer Acrylic Chains</image:title>
      <image:caption>designer-acrylic-chains</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/designer-acrylic-chains-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-16-16-43-41_product_1_1647429221070.jpg?v=1647429227</image:loc>
      <image:title>Brown Designer Acrylic Chains</image:title>
      <image:caption>designer-acrylic-chains-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/designer-acrylic-chains-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-16-16-45-14_product_1_1647429314496.jpg?v=1647429321</image:loc>
      <image:title>Red Designer Acrylic Chains</image:title>
      <image:caption>designer-acrylic-chains-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/designer-acrylic-chains-3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-16-16-47-35_product_1_1647429455086.jpg?v=1647429461</image:loc>
      <image:title>Light Blue Designer Acrylic Chains</image:title>
      <image:caption>designer-acrylic-chains-3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/designer-acrylic-chains-4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-16-16-49-15_product_1_1647429555082.jpg?v=1647429565</image:loc>
      <image:title>Black Designer Acrylic Chains</image:title>
      <image:caption>designer-acrylic-chains-4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/designer-acrylic-chains-6</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-16-16-54-0_product_1_1647429840758.jpg?v=1647429848</image:loc>
      <image:title>Silver Designer Acrylic Chains</image:title>
      <image:caption>designer-acrylic-chains-6</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/designer-acrylic-chains-8</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-16-16-57-31_product_1_1647430051855.jpg?v=1647430057</image:loc>
      <image:title>Light Pink Designer Acrylic Chains</image:title>
      <image:caption>designer-acrylic-chains-8</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/designer-acrylic-chains-9</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-16-16-58-51_product_1_1647430131950.jpg?v=1647430140</image:loc>
      <image:title>Magenta Pink Designer Acrylic Chains</image:title>
      <image:caption>designer-acrylic-chains-9</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-82</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-16-17-9-5_product_1_1647430745701.jpg?v=1647430806</image:loc>
      <image:title>Orange Fancy Oval Czech Glass Beads - 6x8 mm</image:title>
      <image:caption>fancy-glass-beads-82</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-83</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-16-17-15-32_product_1_1647431132334.jpg?v=1647431193</image:loc>
      <image:title>Pale Blue Fancy Circular Czech Glass Beads - 9x11 mm</image:title>
      <image:caption>fancy-glass-beads-83</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-84</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-16-17-19-23_product_1_1647431363658.jpg?v=1647431423</image:loc>
      <image:title>Dark Blue Circular Fancy Czech Glass Beads - 9x11 mm</image:title>
      <image:caption>fancy-glass-beads-84</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-85</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-16-17-37-9_product_1_1647432429952.jpg?v=1647432491</image:loc>
      <image:title>Light Blue Flat Circular Fancy Czech Glass Beads - 5 mm</image:title>
      <image:caption>fancy-glass-beads-85</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-86</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-16-17-41-57_product_1_1647432717176.jpg?v=1647432778</image:loc>
      <image:title>Blue Flat Circular Fancy Czech Glass Beads - 8x10 mm</image:title>
      <image:caption>fancy-glass-beads-86</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-87</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-16-17-47-19_product_1_1647433039598.jpg?v=1647433100</image:loc>
      <image:title>Lavender Purple Oval Fancy Czech Glass Beads - 6x8 mm</image:title>
      <image:caption>fancy-glass-beads-87</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-88</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-16-17-50-44_product_1_1647433244139.jpg?v=1647433305</image:loc>
      <image:title>Dark Red Cylindrical Fancy Czech Glass Beads - 6x9 mm</image:title>
      <image:caption>fancy-glass-beads-88</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-90</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-16-17-55-50_product_1_1647433550202.jpg?v=1647433610</image:loc>
      <image:title>Yellow Cylindrical Fancy Czech Glass Beads- 6x9 mm</image:title>
      <image:caption>fancy-glass-beads-90</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-91</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-16-18-0-7_product_1_1647433807914.jpg?v=1647433868</image:loc>
      <image:title>Light Blue Cylindrical Fancy Czech Glass Beads - 6x9 mm</image:title>
      <image:caption>fancy-glass-beads-91</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalmarblelookacrylicbuttons-01</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/0509c808d7aac3ca4549dc1f8dd40f16.jpg?v=1647435306</image:loc>
      <image:title>Light Red Oval Marble Look Acrylic Buttons</image:title>
      <image:caption>ovalmarblelookacrylicbuttons-01</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalmarblelookacrylicbuttons-02</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/422f9f960860f4fd6e660b4b659e90bf.jpg?v=1647435338</image:loc>
      <image:title>Gray Oval Marble Look Acrylic Buttons</image:title>
      <image:caption>ovalmarblelookacrylicbuttons-02</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalmarblelookacrylicbuttons-03</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/963a22d4a9f66814ebcfe92696e09641.jpg?v=1647435375</image:loc>
      <image:title>Maroon Oval Marble Look Acrylic Buttons</image:title>
      <image:caption>ovalmarblelookacrylicbuttons-03</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalmarblelookacrylicbuttons-04</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/b776f2d607e8c352e2fcc33cfcfccffa.jpg?v=1647435406</image:loc>
      <image:title>Light Brown Oval Marble Look Acrylic Buttons</image:title>
      <image:caption>ovalmarblelookacrylicbuttons-04</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalmarblelookacrylicbuttons-05</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/86aade8e9a670b62f0ac2acb01a4f71a.jpg?v=1647435439</image:loc>
      <image:title>Blue Oval Marble Look Acrylic Buttons</image:title>
      <image:caption>ovalmarblelookacrylicbuttons-05</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalmarblelookacrylicbuttons-06</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/eb028cb96c18c9bc0456e5434ea133f3.jpg?v=1647435470</image:loc>
      <image:title>Brown Oval Marble Look Acrylic Buttons</image:title>
      <image:caption>ovalmarblelookacrylicbuttons-06</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalmarblelookacrylicbuttons-07</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/3e7e03305a81fb11d2a01b2ebdde0eed.jpg?v=1647435503</image:loc>
      <image:title>Red Oval Marble Look Acrylic Buttons</image:title>
      <image:caption>ovalmarblelookacrylicbuttons-07</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalmarblelookacrylicbuttons-08</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/177feaf5515694c2fc29a448bcb51a46.jpg?v=1647435566</image:loc>
      <image:title>Dark Green Oval Marble Look Acrylic Buttons</image:title>
      <image:caption>ovalmarblelookacrylicbuttons-08</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalmarblelookacrylicbuttons-09</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/66951f22f91d813a5b20665891fabc2b.jpg?v=1647435599</image:loc>
      <image:title>Dark Brown Oval Marble Look Acrylic Buttons</image:title>
      <image:caption>ovalmarblelookacrylicbuttons-09</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalmarblelookacrylicbuttons-10</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/752d90055b1ae432d4228ed6af1711b1.jpg?v=1647435631</image:loc>
      <image:title>Light Blue Oval Marble Look Acrylic Buttons</image:title>
      <image:caption>ovalmarblelookacrylicbuttons-10</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalmarblelookacrylicbuttons-11</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/037ab742c01239a944156b7eefcf4793.jpg?v=1647435664</image:loc>
      <image:title>Dark Pink Oval Marble Look Acrylic Buttons</image:title>
      <image:caption>ovalmarblelookacrylicbuttons-11</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalmarblelookacrylicbuttons-12</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/02f77cfb9131d4b27c0e53c4318d3b71.jpg?v=1647435700</image:loc>
      <image:title>Purple Oval Marble Look Acrylic Buttons</image:title>
      <image:caption>ovalmarblelookacrylicbuttons-12</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalmarblelookacrylicbuttons-13</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d50d0e74851b14cbc61b8e558238fcaa.jpg?v=1647435732</image:loc>
      <image:title>Pink Oval Marble Look Acrylic Buttons</image:title>
      <image:caption>ovalmarblelookacrylicbuttons-13</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalmarblelookacrylicbuttons-14</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/0d8c701387d7dd61cb6484e9c86c0593.jpg?v=1647435766</image:loc>
      <image:title>Dark Orange Oval Marble Look Acrylic Buttons</image:title>
      <image:caption>ovalmarblelookacrylicbuttons-14</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalmarblelookacrylicbuttons-15</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/b1d47cef3c516f7085d0b0eea5c8df4e.jpg?v=1647435829</image:loc>
      <image:title>Light Yellow Oval Marble Look Acrylic Buttons</image:title>
      <image:caption>ovalmarblelookacrylicbuttons-15</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalmarblelookacrylicbuttons-16</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/b4de27424dc1a123a490eb6bc50d1588.jpg?v=1647435862</image:loc>
      <image:title>Light Green Oval Marble Look Acrylic Buttons</image:title>
      <image:caption>ovalmarblelookacrylicbuttons-16</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalmarblelookacrylicbuttons-17</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d72be3f590a754237d2f19d958fcb108.jpg?v=1647435899</image:loc>
      <image:title>Green Oval Marble Look Acrylic Buttons</image:title>
      <image:caption>ovalmarblelookacrylicbuttons-17</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalmarblelookacrylicbuttons-18</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/27ee6a38d4381d39e68ae45bf34b8944.jpg?v=1647435932</image:loc>
      <image:title>Rust Brown Oval Marble Look Acrylic Buttons</image:title>
      <image:caption>ovalmarblelookacrylicbuttons-18</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalmarblelookacrylicbuttons-19</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/082b2231c8f94522c4c97584e761f17e.jpg?v=1647435966</image:loc>
      <image:title>Dark Blue Oval Marble Look Acrylic Buttons</image:title>
      <image:caption>ovalmarblelookacrylicbuttons-19</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalmarblelookacrylicbuttons-20</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6071777eb9e6f540ad1ad2357054b31a.jpg?v=1647436002</image:loc>
      <image:title>Beige Oval Marble Look Acrylic Buttons</image:title>
      <image:caption>ovalmarblelookacrylicbuttons-20</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalmarblelookacrylicbuttons-21</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/16f90af77b8911322b73ce8965187a9e.jpg?v=1647436065</image:loc>
      <image:title>Light Gray Oval Marble Look Acrylic Buttons</image:title>
      <image:caption>ovalmarblelookacrylicbuttons-21</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalmarblelookacrylicbuttons-22</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9fa750135e88662f731f727f4713b8ef.jpg?v=1647436096</image:loc>
      <image:title>Light Yellow Oval Marble Look Acrylic Buttons</image:title>
      <image:caption>ovalmarblelookacrylicbuttons-22</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalmarblelookacrylicbuttons-23</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cd9456165df662e742445a29077db29d.jpg?v=1647436132</image:loc>
      <image:title>Deep Yellow Oval Marble Look Acrylic Buttons</image:title>
      <image:caption>ovalmarblelookacrylicbuttons-23</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalmarblelookacrylicbuttons-24</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/26fa036a675e920770cbd15d4ed168c5.jpg?v=1647436168</image:loc>
      <image:title>Black Oval Marble Look Acrylic Buttons</image:title>
      <image:caption>ovalmarblelookacrylicbuttons-24</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovaldesigneracrylicbuttons-01</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2a2d2fcb435db1beaec11d074625823e.jpg?v=1647437059</image:loc>
      <image:title>Blue Golden Oval Designer Acrylic Button</image:title>
      <image:caption>ovaldesigneracrylicbuttons-01</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovaldesigneracrylicbuttons-02</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/fa4168913c66833ae33e3de4d7b76ac0.jpg?v=1647437097</image:loc>
      <image:title>Purple Golden Oval Designer Acrylic Button</image:title>
      <image:caption>ovaldesigneracrylicbuttons-02</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovaldesigneracrylicbuttons-03</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/22486b6e20e284c605e257dc794ba138.jpg?v=1647437135</image:loc>
      <image:title>Dark Blue Golden Oval Designer Acrylic Button</image:title>
      <image:caption>ovaldesigneracrylicbuttons-03</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovaldesigneracrylicbuttons-04</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6d0283a44ad6d5927659c25f6de19efa.jpg?v=1647437179</image:loc>
      <image:title>Dark Pink Golden Oval Designer Acrylic Button</image:title>
      <image:caption>ovaldesigneracrylicbuttons-04</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovaldesigneracrylicbuttons-05</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/7ad6ab7ca311c68faabbdd1ff1de362b.jpg?v=1647437218</image:loc>
      <image:title>Light Blue Golden Oval Designer Acrylic Button</image:title>
      <image:caption>ovaldesigneracrylicbuttons-05</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovaldesigneracrylicbuttons-06</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/f35ef1e38775c667ce359487233911b2.jpg?v=1647437253</image:loc>
      <image:title>Light Yellow Golden Oval Designer Acrylic Button</image:title>
      <image:caption>ovaldesigneracrylicbuttons-06</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovaldesigneracrylicbuttons-07</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/60cd4db82272dfb626998e82ea0b7640.jpg?v=1647437287</image:loc>
      <image:title>Purple Golden Oval Designer Acrylic Button</image:title>
      <image:caption>ovaldesigneracrylicbuttons-07</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovaldesigneracrylicbuttons-08</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d410b31159c9c4f689ca0798e8257205.jpg?v=1647437352</image:loc>
      <image:title>Multicolour Golden Oval Designer Acrylic Button</image:title>
      <image:caption>ovaldesigneracrylicbuttons-08</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovaldesigneracrylicbuttons-09</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/00688cab5a876ce7fbaa6f6d75b3cd80.jpg?v=1647437386</image:loc>
      <image:title>Yellow Golden Oval Designer Acrylic Button</image:title>
      <image:caption>ovaldesigneracrylicbuttons-09</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovaldesigneracrylicbuttons-010</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6e438a105b34387d0465805e017a8b5b.jpg?v=1647437425</image:loc>
      <image:title>Green Golden Oval Designer Acrylic Button</image:title>
      <image:caption>ovaldesigneracrylicbuttons-010</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-color-fine-shape-deer-brooch-for-attractive-looks-for-party-wear-clothes-for-men-and-women</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-16-23-56-58_product_1_1647509218584.jpg?v=1647455209</image:loc>
      <image:title>Golden Deer Designer Brooch</image:title>
      <image:caption>golden-color-fine-shape-deer-brooch-for-attractive-looks-for-party-wear-clothes-for-men-and-women</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-color-fine-deer-shape-brooch-for-fancy-attractive-looks-for-men-women</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-17-0-4-9_product_1_1647509649184.jpg?v=1647455683</image:loc>
      <image:title>Golden Fancy Deer Brooch</image:title>
      <image:caption>golden-color-fine-deer-shape-brooch-for-fancy-attractive-looks-for-men-women</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/awesome-snake-design-brooch-with-beautiful-fine-shape-for-mens-and-womens-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-17-0-8-43_product_1_1647509923369.jpg?v=1647455919</image:loc>
      <image:title>Golden Black Snake Designer Brooch</image:title>
      <image:caption>awesome-snake-design-brooch-with-beautiful-fine-shape-for-mens-and-womens-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/beige-sequins-motifs-embroidered-chanderi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-17-8-35-19_product_3_1647486319611.jpg?v=1746595040</image:loc>
      <image:title>Beige Sequins Floral Motifs Embroidered Chanderi Fabric</image:title>
      <image:caption>beige-sequins-motifs-embroidered-chanderi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/royal-blue-golden-sequins-embroidered-motifs-georgette</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-17-8-39-41_product_1_1647486581231.jpg?v=1647486596</image:loc>
      <image:title>Royal Blue Golden Sequins Floral Motifs Embroidered Georgette Fabric</image:title>
      <image:caption>royal-blue-golden-sequins-embroidered-motifs-georgette</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-white-chikankari-embroidered-satin-finish-jam-cotton</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-17-8-46-47_product_1_1647487007392.jpg?v=1647487052</image:loc>
      <image:title>Black White Chikankari Flowers Embroidered Satin Jam Cotton Fabric</image:title>
      <image:caption>black-white-chikankari-embroidered-satin-finish-jam-cotton</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-93</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-17-13-2-51_product_1_1647502371692.jpg?v=1647502436</image:loc>
      <image:title>Baby Pink Fancy Czech Glass Beads - 12 mm</image:title>
      <image:caption>fancy-glass-beads-93</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-94</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-17-13-8-1_product_1_1647502681699.jpg?v=1647502747</image:loc>
      <image:title>Blue Designer Circular Czech Glass Beads - 6 mm</image:title>
      <image:caption>fancy-glass-beads-94</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-95</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-17-13-10-29_product_1_1647502829222.jpg?v=1647502892</image:loc>
      <image:title>White Black Cylindrical Fancy Czech Glass Beads - 7x7 mm</image:title>
      <image:caption>fancy-glass-beads-95</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-96</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-17-13-43-8_product_1_1647504788645.jpg?v=1647504851</image:loc>
      <image:title>Blue Fancy Oval Czech Glass Beads- 18x20 mm</image:title>
      <image:caption>fancy-glass-beads-96</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/gray-flat-circular-plastic-sequins-6-mm-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Gray_Flat_Circular_Plastic_Sequins_-_6_mm__product_1_1614428656362_f913ebfe-1675-4823-9ba7-aea0ac459c31.jpg?v=1647519271</image:loc>
      <image:title>Gray Flat Circular Plastic Sequins - 6 mm</image:title>
      <image:caption>gray-flat-circular-plastic-sequins-6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-metallic-flat-circular-plastic-sequins-5-mm-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Silver_Metallic_Flat_Circular_Plastic_Sequins_-_5_mm__product_1_1614685511129_f2695146-d398-4da9-8b7a-d2468dfdc60e.jpg?v=1647519350</image:loc>
      <image:title>Silver Metallic Flat Circular Plastic Sequins - 5 mm</image:title>
      <image:caption>silver-metallic-flat-circular-plastic-sequins-5-mm-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/speramint-green-color-silk-thread-tassels</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-19-12-27-12_product_1_1647673032926.jpg?v=1647673039</image:loc>
      <image:title>Speramint Green Silk Thread Tassels</image:title>
      <image:caption>speramint-green-color-silk-thread-tassels</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-sequins-geometric-embroidered-chanderi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-19-12-35-54_product_1_1647673554530.jpg?v=1647673580</image:loc>
      <image:title>Pink Sequins Geometric Embroidered Chanderi Fabric</image:title>
      <image:caption>peach-sequins-geometric-embroidered-chanderi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-taffeta-silk-with-golden-dori-work-embroidery-allover</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-20-12-32-17_product_1_1647759737798.jpg?v=1647759746</image:loc>
      <image:title>Blue Golden Dori Work Floral Motifs Embroidered Taffeta Silk Fabric</image:title>
      <image:caption>blue-taffeta-silk-with-golden-dori-work-embroidery-allover</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/bright-pink-sequins-embroidered-malai-satin</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-20-13-9-40_product_1_1647761980871.jpg?v=1647761993</image:loc>
      <image:title>Bright Pink Sequins Embroidered Floral Motifs Malai Satin Fabric</image:title>
      <image:caption>bright-pink-sequins-embroidered-malai-satin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/slate-gray-thread-sequins-embroidered-chanderi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-21-10-3-39_product_1_1647837219654.jpg?v=1647837285</image:loc>
      <image:title>Slate Gray Thread &amp; Sequins Embroidered Flowers Chanderi Fabric</image:title>
      <image:caption>slate-gray-thread-sequins-embroidered-chanderi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/brown-white-moose-printed-pure-cotton-rayon-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-21-12-10-24_product_1_1647844824698.jpg?v=1647844830</image:loc>
      <image:title>Brown White Moose Printed Cotton Rayon Fabric</image:title>
      <image:caption>brown-white-moose-printed-pure-cotton-rayon-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-9</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-21-13-36-55_product_1_1647850015580.jpg?v=1647850022</image:loc>
      <image:title>Orange Uneven Fancy Czech Glass Beads</image:title>
      <image:caption>fancy-glass-beads-9</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-21</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-21-13-39-46_product_1_1647850186489.jpg?v=1647850192</image:loc>
      <image:title>Light Pink Circular Fancy Czech Glass Beads</image:title>
      <image:caption>fancy-glass-beads-21</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-44</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-21-13-49-57_product_1_1647850797824.jpg?v=1647850803</image:loc>
      <image:title>Green Brown Oval Fancy Czech Glass Beads</image:title>
      <image:caption>fancy-glass-beads-44</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-97</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-21-13-51-55_product_1_1647850915122.jpg?v=1647850920</image:loc>
      <image:title>Blue Brown Fancy Czech Glass Beads</image:title>
      <image:caption>fancy-glass-beads-97</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-white-embroidered-chikankari-chanderi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-22-11-14-17_product_1_1647927857991.jpg?v=1647927883</image:loc>
      <image:title>Green White Flowers Embroidered Chikankari Chanderi Fabric</image:title>
      <image:caption>green-white-embroidered-chikankari-chanderi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-golden-geometric-sequins-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-22-11-17-42_product_1_1647928062803.jpg?v=1647928114</image:loc>
      <image:title>Pink Golden Geometric Sequins Embroidered Chanderi Fabric</image:title>
      <image:caption>pink-golden-geometric-sequins-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/beige-sequins-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-22-11-25-53_product_1_1647928553435.jpg?v=1647928570</image:loc>
      <image:title>Beige Sequins Flowers Embroidered Chanderi Fabric</image:title>
      <image:caption>beige-sequins-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons17</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c9889fae1792d2d7be95f3b65789f151_e628c28d-bd5f-4575-9a93-4dd21a7915a5.jpg?v=1647949423</image:loc>
      <image:title>Yellow Designer Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons17</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons18</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/44ba8453290cd621659f8fd0b60725a8_13b1d537-1ada-499e-b2e9-ad438987985a.jpg?v=1647949458</image:loc>
      <image:title>Maroon Designer Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons18</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons19</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/4376075e8153d3f76d59fca02c2ec67e_e6f53467-7956-43e7-a1a0-9b39769f70bb.jpg?v=1647949495</image:loc>
      <image:title>Deep Pink Designer Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons19</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons20</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/be05aaee15654021c0d3f40c42b3eccb_a04ad5bf-021f-4ae2-8657-57984e519aeb.jpg?v=1647949532</image:loc>
      <image:title>Dark Brown Designer Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons20</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons21</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/dca3b59cf67ee251b6f7ed600283ad82_6d64d87b-92c9-4cf8-8b8a-d8ccf38fbcbf.jpg?v=1647949597</image:loc>
      <image:title>Orange Designer Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons21</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons22</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cb01b1d9644246559821a32d0cf92103_395d1a0a-5fd9-4011-8c04-18e59315458d.jpg?v=1647949631</image:loc>
      <image:title>Dark Green Designer Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons22</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons23</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cf8fe69d96a78064a4b452a29125934a_22de1915-1435-4f7c-8a8a-524d5b9be062.jpg?v=1647949666</image:loc>
      <image:title>Dark Turquoise Designer Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons23</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons24</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/eccf39d2616235b408c56ba954afdd1f_451efbc9-a097-4a89-b6ba-8faa2d9686b7.jpg?v=1647949700</image:loc>
      <image:title>Navy Blue Designer Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons24</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundmarbleacrylicbuttons01</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2ebdcd6ef1d091a62436cfa06b0de7b1.jpg?v=1648809144</image:loc>
      <image:title>Dark Blue Round Marble Acrylic Buttons</image:title>
      <image:caption>roundmarbleacrylicbuttons01</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundmarbleacrylicbuttons02</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/f93c7a7bb9fdaf59c3fc21731db16bb8.jpg?v=1648809183</image:loc>
      <image:title>Orange Round Marble Acrylic Buttons</image:title>
      <image:caption>roundmarbleacrylicbuttons02</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundmarbleacrylicbuttons03</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/b49f2e999535da39dd60259924e24993.jpg?v=1648809222</image:loc>
      <image:title>Dark Pink Round Marble Acrylic Buttons</image:title>
      <image:caption>roundmarbleacrylicbuttons03</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundmarbleacrylicbuttons04</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/ef4a97c8ed9825630b28dd724974f231.jpg?v=1648809261</image:loc>
      <image:title>Dark Brown Round Marble Acrylic Buttons</image:title>
      <image:caption>roundmarbleacrylicbuttons04</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundmarbleacrylicbuttons05</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6f1bf376bc286176365ac839acc56432.jpg?v=1648809299</image:loc>
      <image:title>Light Brown Round Marble Acrylic Buttons</image:title>
      <image:caption>roundmarbleacrylicbuttons05</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundmarbleacrylicbuttons06</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/e9e18abcd5e068742d61dcf7caa0f7fd.jpg?v=1648809339</image:loc>
      <image:title>Light Yellow Round Marble Acrylic Buttons</image:title>
      <image:caption>roundmarbleacrylicbuttons06</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundmarbleacrylicbuttons07</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/37adc52ec36c69429a589723dd9c887f.jpg?v=1648809380</image:loc>
      <image:title>Yellow Round Marble Acrylic Buttons</image:title>
      <image:caption>roundmarbleacrylicbuttons07</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundmarbleacrylicbuttons08</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/dae63b4bb9ba54b49c17bddd27b77958.jpg?v=1648809450</image:loc>
      <image:title>Pink Round Marble Acrylic Buttons</image:title>
      <image:caption>roundmarbleacrylicbuttons08</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundmarbleacrylicbuttons09</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6315b9116d68030483ffe758f79322e6.jpg?v=1648809491</image:loc>
      <image:title>Light Orange Round Marble Acrylic Buttons</image:title>
      <image:caption>roundmarbleacrylicbuttons09</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundmarbleacrylicbuttons10</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2a431489b69326430f2ddb8bb16b9ec5.jpg?v=1648809529</image:loc>
      <image:title>Dark Red Round Marble Acrylic Buttons</image:title>
      <image:caption>roundmarbleacrylicbuttons10</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundmarbleacrylicbuttons11</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2dd31ea2e78bbbde1391fc70149578d2.jpg?v=1648809567</image:loc>
      <image:title>Bright Green Round Marble Acrylic Buttons</image:title>
      <image:caption>roundmarbleacrylicbuttons11</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundmarbleacrylicbuttons12</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/47deedce10ae7b0bb716037c0863d399.jpg?v=1648809606</image:loc>
      <image:title>Deep Green Round Marble Acrylic Buttons</image:title>
      <image:caption>roundmarbleacrylicbuttons12</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundmarbleacrylicbuttons13</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/03a340ea63dc8b2a259e6bb17c971873.jpg?v=1648809646</image:loc>
      <image:title>Dark Green Round Marble Acrylic Buttons</image:title>
      <image:caption>roundmarbleacrylicbuttons13</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundmarbleacrylicbuttons14</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/8964959b77546e021e7a6b8ebab31881.jpg?v=1648809685</image:loc>
      <image:title>Bright Blue Round Marble Acrylic Buttons</image:title>
      <image:caption>roundmarbleacrylicbuttons14</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundmarbleacrylicbuttons15</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/5b3fc7090ffcbfd5be82c18022ec0f59.jpg?v=1648809755</image:loc>
      <image:title>Silver Round Marble Acrylic Buttons</image:title>
      <image:caption>roundmarbleacrylicbuttons15</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundmarbleacrylicbuttons16</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/82dac7eaf748ef85abe7bf66c25509e1.jpg?v=1648809794</image:loc>
      <image:title>Deep Blue Round Marble Acrylic Buttons</image:title>
      <image:caption>roundmarbleacrylicbuttons16</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundmarbleacrylicbuttons17</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/e465f8fad574bf542615900bb17cc294.jpg?v=1648809832</image:loc>
      <image:title>Light Brown Round Marble Acrylic Buttons</image:title>
      <image:caption>roundmarbleacrylicbuttons17</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundmarbleacrylicbuttons18</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c7963dcf7ad1cd82d03c92ee8b66329e.jpg?v=1648809875</image:loc>
      <image:title>Dark Purple Round Marble Acrylic Buttons</image:title>
      <image:caption>roundmarbleacrylicbuttons18</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundmarbleacrylicbuttons19</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6c427cb1468a730096366360e6ccfc1e.jpg?v=1648809915</image:loc>
      <image:title>Dark Brown Round Marble Acrylic Buttons</image:title>
      <image:caption>roundmarbleacrylicbuttons19</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundmarbleacrylicbuttons20</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/5c0e35b67bda92c81becc1c85fcd2d4a.jpg?v=1648809956</image:loc>
      <image:title>Bright Dark Red Round Marble Acrylic Buttons</image:title>
      <image:caption>roundmarbleacrylicbuttons20</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundmarbleacrylicbuttons21</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/576de70d9daf173fb6050970bd1a0896.jpg?v=1648810014</image:loc>
      <image:title>Yellow Round Marble Acrylic Buttons</image:title>
      <image:caption>roundmarbleacrylicbuttons21</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundmarbleacrylicbuttons23</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1b4567fb7d060b4540a5e8138d4bdd4f.jpg?v=1648810075</image:loc>
      <image:title>Bright Pink Round Marble Acrylic Buttons</image:title>
      <image:caption>roundmarbleacrylicbuttons23</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/squaremarbleacrylicbuttons01</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/18a98b6f8df11ea8ff661c51962e5a60.jpg?v=1648812433</image:loc>
      <image:title>Dark Brown Square Marble Acrylic Buttons</image:title>
      <image:caption>squaremarbleacrylicbuttons01</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/squaremarbleacrylicbuttons02</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9403c58f236dcdc65f14964bd0552562_40981a96-318b-470a-af7c-0d4a84686659.jpg?v=1648812476</image:loc>
      <image:title>Dark Pink Square Marble Acrylic Buttons</image:title>
      <image:caption>squaremarbleacrylicbuttons02</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/squaremarbleacrylicbuttons03</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/bd3f2e3d4d8d724d6d34761dfdd341d4_d8315dff-de12-4ab5-952d-9101736b0825.jpg?v=1648812517</image:loc>
      <image:title>Yellow Square Marble Acrylic Buttons</image:title>
      <image:caption>squaremarbleacrylicbuttons03</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/squaremarbleacrylicbuttons04</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1c31726bb9e69630ba6788785d1703c7_e88155fd-05e1-4104-83a1-d337bfcbe091.jpg?v=1648812559</image:loc>
      <image:title>Navy Blue Square Marble Acrylic Buttons</image:title>
      <image:caption>squaremarbleacrylicbuttons04</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/squaremarbleacrylicbuttons05</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d9da6fbcc132aa2d75b7ded3741f4dcb_230f7cc8-8a4e-4495-9093-a3932a9eed1d.jpg?v=1648812599</image:loc>
      <image:title>Black Square Marble Acrylic Buttons</image:title>
      <image:caption>squaremarbleacrylicbuttons05</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/squaremarbleacrylicbuttons06</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/4bec2edb8ca8790b36ecfca433ae611b_3b964b94-d5f5-4677-bbf1-32bb636fcc55.jpg?v=1648812642</image:loc>
      <image:title>Silver Square Marble Acrylic Buttons</image:title>
      <image:caption>squaremarbleacrylicbuttons06</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/squaremarbleacrylicbuttons07</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/b4d4f739e90ed37feb08a5123a4360b7_c0ba0930-17a9-45c7-9b7a-e6afecdc783a.jpg?v=1648812682</image:loc>
      <image:title>Dark Orange Square Marble Acrylic Buttons</image:title>
      <image:caption>squaremarbleacrylicbuttons07</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/squaremarbleacrylicbuttons08</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cb416e0a030687707af9ec80df4d174b_eccaba33-1dcb-4576-9c4a-410a047df13b.jpg?v=1648812751</image:loc>
      <image:title>Deep Green Square Marble Acrylic Buttons</image:title>
      <image:caption>squaremarbleacrylicbuttons08</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/squaremarbleacrylicbuttons09</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9eec916cabc3c489338e9b987592c6d1_0d4a49fc-1731-4d85-a698-55475ef3cbc3.jpg?v=1648812790</image:loc>
      <image:title>Bright Yellow Square Marble Acrylic Buttons</image:title>
      <image:caption>squaremarbleacrylicbuttons09</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/squaremarbleacrylicbuttons10</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/648ca201b3df0e47cf3524142adbb808_64b4532c-b1b1-496e-9664-c77f490db878.jpg?v=1648812833</image:loc>
      <image:title>Peach Orange Square Marble Acrylic Buttons</image:title>
      <image:caption>squaremarbleacrylicbuttons10</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/squaremarbleacrylicbuttons11</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/12e89f1ee6818f7365de0e7b2cf68834_b5088998-95c1-4b4b-814f-bcec847462a8.jpg?v=1648812875</image:loc>
      <image:title>Dark Purple Square Marble Acrylic Buttons</image:title>
      <image:caption>squaremarbleacrylicbuttons11</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/squaremarbleacrylicbuttons12</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/862e6e13238d0cf7ba9b2ade2fbf6282_70ccda2f-6870-4c15-a483-b7d8b6e64322.jpg?v=1648812916</image:loc>
      <image:title>Light Yellow Square Marble Acrylic Buttons</image:title>
      <image:caption>squaremarbleacrylicbuttons12</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/squaremarbleacrylicbuttons13</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6fbf6103aebcd22e1359a90510f32079_a77ec60b-b44e-4ea0-b439-1c974f874df0.jpg?v=1648812955</image:loc>
      <image:title>Deep Red Square Marble Acrylic Buttons</image:title>
      <image:caption>squaremarbleacrylicbuttons13</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/squaremarbleacrylicbuttons14</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/574c8323f45c112e966da923b5105b85_ca6873f0-c80c-4524-b455-e75aa165cbc6.jpg?v=1648812994</image:loc>
      <image:title>Light Brown Square Marble Acrylic Buttons</image:title>
      <image:caption>squaremarbleacrylicbuttons14</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/squaremarbleacrylicbuttons15</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/7be9cf18dd00cc345901ec27f54eefed_c9582387-1e40-4461-afd9-9f43911277ef.jpg?v=1648813061</image:loc>
      <image:title>Dark Brown Square Marble Acrylic Buttons</image:title>
      <image:caption>squaremarbleacrylicbuttons15</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/squaremarbleacrylicbuttons16</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/f8ed5c1b4b63d1fa217a4ac0005c4d75_b86ca85d-d1b5-4be9-8a49-00065feca5df.jpg?v=1648813098</image:loc>
      <image:title>Peach Brown Square Marble Acrylic Buttons</image:title>
      <image:caption>squaremarbleacrylicbuttons16</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/squaremarbleacrylicbuttons17</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/17bd936cd7a79a6265bf92a81d7231b0_0ae971ca-15f1-4fa0-945a-f0e7e8cafa4a.jpg?v=1648813137</image:loc>
      <image:title>Deep Brown Square Marble Acrylic Buttons</image:title>
      <image:caption>squaremarbleacrylicbuttons17</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/squaremarbleacrylicbuttons18</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/63da3cd42d5f237912f66d517bda587b_a2373644-ceba-48ac-9adb-071875717afb.jpg?v=1648813175</image:loc>
      <image:title>Light Blue Square Marble Acrylic Buttons</image:title>
      <image:caption>squaremarbleacrylicbuttons18</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/squaremarbleacrylicbuttons19</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/ff67ab004b279ce05c658234982f9f93_9234f59a-ccf5-467a-8842-d09833ebbc67.jpg?v=1648813216</image:loc>
      <image:title>Bright Pink Square Marble Acrylic Buttons</image:title>
      <image:caption>squaremarbleacrylicbuttons19</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/squaremarbleacrylicbuttons20</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/e20ba624f4e0895f471806054cad4a19_11f3084a-9faa-4978-8a2c-e1a355aa12f8.jpg?v=1648813255</image:loc>
      <image:title>Bright Green Square Marble Acrylic Buttons</image:title>
      <image:caption>squaremarbleacrylicbuttons20</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/squaremarbleacrylicbuttons21</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/0198cc83338482619ad8db691e6e7d85_8330639e-d096-4740-901f-115181e1827a.jpg?v=1648813324</image:loc>
      <image:title>Deep Green Square Marble Acrylic Buttons</image:title>
      <image:caption>squaremarbleacrylicbuttons21</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/squaremarbleacrylicbuttons22</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/f776f180ebe15817d10e1d4f9e675155_a0438281-ca93-4c30-8315-c81becc18f70.jpg?v=1648813364</image:loc>
      <image:title>Deep Blue Square Marble Acrylic Buttons</image:title>
      <image:caption>squaremarbleacrylicbuttons22</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/squaremarbleacrylicbuttons23</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9d1447e7322c2def663688579601dbd6_8cc25d48-240b-4d94-9141-bc3b4987fc01.jpg?v=1648813404</image:loc>
      <image:title>Bright Pink Square Marble Acrylic Buttons</image:title>
      <image:caption>squaremarbleacrylicbuttons23</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/squaremarbleacrylicbuttons24</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cf99617c10acf02796c985f84b9e2698_25f6dd8a-690d-4ae6-952f-4c5013883431.jpg?v=1648813444</image:loc>
      <image:title>Black Square Marble Acrylic Buttons</image:title>
      <image:caption>squaremarbleacrylicbuttons24</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundglitteringfabricmoldbuttons01</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/74245ae509c211a2697cd15842d0c4fd.jpg?v=1648814043</image:loc>
      <image:title>Golden Round Glittering Fabric Mold Buttons</image:title>
      <image:caption>roundglitteringfabricmoldbuttons01</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundglitteringfabricmoldbuttons02</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/745e088a6c061070ccedcdc44079fee2.jpg?v=1648814081</image:loc>
      <image:title>Black Round Glittering Fabric Mold Buttons</image:title>
      <image:caption>roundglitteringfabricmoldbuttons02</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundglitteringfabricmoldbuttons03</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a99d0511a8c86e535ab512d87fcc8f1c.jpg?v=1648814121</image:loc>
      <image:title>Blue Round Glittering Fabric Mold Buttons</image:title>
      <image:caption>roundglitteringfabricmoldbuttons03</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundglitteringfabricmoldbuttons04</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cb58907c68c807071da0d28ddc3fcc78.jpg?v=1648814159</image:loc>
      <image:title>Purple Round Glittering Fabric Mold Buttons</image:title>
      <image:caption>roundglitteringfabricmoldbuttons04</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundglitteringfabricmoldbuttons05</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/49acf123066eb28a5a027f34333032a3.jpg?v=1648814199</image:loc>
      <image:title>Dark Silver Round Glittering Fabric Mold Buttons</image:title>
      <image:caption>roundglitteringfabricmoldbuttons05</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundglitteringfabricmoldbuttons06</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/f59a3d08314ed6ee135be22e30ac692e.jpg?v=1648814237</image:loc>
      <image:title>Light Golden Round Glittering Fabric Mold Buttons</image:title>
      <image:caption>roundglitteringfabricmoldbuttons06</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundglitteringfabricmoldbuttons07</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2c74854ff825936da8210df76ae12cea.jpg?v=1648814278</image:loc>
      <image:title>Copper Round Glittering Fabric Mold Buttons</image:title>
      <image:caption>roundglitteringfabricmoldbuttons07</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundglitteringfabricmoldbuttons08</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6d58490070d80528d06e41f87fd041bc.jpg?v=1648814347</image:loc>
      <image:title>Silver Round Glittering Fabric Mold Buttons</image:title>
      <image:caption>roundglitteringfabricmoldbuttons08</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundglitteringfabricmoldbuttons09</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/3bf9cc97617a00fdc08ca58ee470b65f.jpg?v=1648814385</image:loc>
      <image:title>Bright Pink Round Glittering Fabric Mold Buttons</image:title>
      <image:caption>roundglitteringfabricmoldbuttons09</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundglitteringfabricmoldbuttons10</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/ec2e30e339bf3e13c3348ee58bce962d.jpg?v=1648814429</image:loc>
      <image:title>Red Round Glittering Fabric Mold Buttons</image:title>
      <image:caption>roundglitteringfabricmoldbuttons10</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundglitteringfabricmoldbuttons11</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2c13dcdcd765b2d6ad465c346d478c6d.jpg?v=1648814470</image:loc>
      <image:title>Light Purple Round Glittering Fabric Mold Buttons</image:title>
      <image:caption>roundglitteringfabricmoldbuttons11</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundglitteringfabricmoldbuttons12</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/103ee927c1fa7258bb1017f0c7343d6f.jpg?v=1648814509</image:loc>
      <image:title>Light Golden Round Glittering Fabric Mold Buttons</image:title>
      <image:caption>roundglitteringfabricmoldbuttons12</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundglitteringfabricmoldbuttons13</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1613f5a812607dbecef50d9bed175242.jpg?v=1648814548</image:loc>
      <image:title>Bright Golden Round Glittering Fabric Mold Buttons</image:title>
      <image:caption>roundglitteringfabricmoldbuttons13</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundglitteringfabricmoldbuttons14</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/4f57124ddc9a26f61ca961c346e3502d.jpg?v=1648814587</image:loc>
      <image:title>Magenta Pink Round Glittering Fabric Mold Buttons</image:title>
      <image:caption>roundglitteringfabricmoldbuttons14</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundglitteringfabricmoldbuttons15</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/85c18dc29fefde5624c3973cdb10b80b.jpg?v=1648814656</image:loc>
      <image:title>Dark Red Round Glittering Fabric Mold Buttons</image:title>
      <image:caption>roundglitteringfabricmoldbuttons15</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundglitteringfabricmoldbuttons16</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/309f6ea3ea4be906a6baf04c60280a6c.jpg?v=1648814694</image:loc>
      <image:title>Pink Round Glittering Fabric Mold Buttons</image:title>
      <image:caption>roundglitteringfabricmoldbuttons16</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundgranularacrylicbuttons10</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/e40df93e0d2c7d146960d878bfef2c71_a4a6b7d9-89b4-40e6-99c9-9cfb80587dd0.jpg?v=1648817014</image:loc>
      <image:title>Orange Round Granular Acrylic Buttons</image:title>
      <image:caption>roundgranularacrylicbuttons10</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundgranularacrylicbuttons11</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cf0a1b0c2bc35faa281845bf96c37100_7ffb18b9-30de-413d-a7cb-fcd6a9f01117.jpg?v=1648817053</image:loc>
      <image:title>Red Round Granular Acrylic Buttons</image:title>
      <image:caption>roundgranularacrylicbuttons11</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundgranularacrylicbuttons12</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/94241d82beec9baef8c4e592417aa8b3_d7137bd5-b016-46d4-8e0e-36602364319c.jpg?v=1648817092</image:loc>
      <image:title>Dark Green Round Granular Acrylic Buttons</image:title>
      <image:caption>roundgranularacrylicbuttons12</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundgranularacrylicbuttons13</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a84a4c60a434c8ba7c04b3d449baa862_837d208b-0dcb-416b-8537-0f359cd83562.jpg?v=1648817129</image:loc>
      <image:title>Yellow Round Granular Acrylic Buttons</image:title>
      <image:caption>roundgranularacrylicbuttons13</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundgranularacrylicbuttons14</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a559a79eacac9572844c406f5253aa88_01446d4e-c83f-4dc4-a526-5285510d0fc6.jpg?v=1648817167</image:loc>
      <image:title>Brown Round Granular Acrylic Buttons</image:title>
      <image:caption>roundgranularacrylicbuttons14</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundgranularacrylicbuttons15</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/38e984f627af5b1294237e809722332b_0d09e6c8-ad31-4ec7-94ba-e8c3c5231e03.jpg?v=1648817234</image:loc>
      <image:title>Lime Green Round Granular Acrylic Buttons</image:title>
      <image:caption>roundgranularacrylicbuttons15</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundgranularacrylicbuttons16</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/36b9c5defb073b61b11798c7a7b3f852_d45d25b5-cf99-421d-ad90-64b9e1b662bc.jpg?v=1648817272</image:loc>
      <image:title>Blue Round Granular Acrylic Buttons</image:title>
      <image:caption>roundgranularacrylicbuttons16</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-high-quality-jam-cotton</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-23-10-30-59_product_2_1648011659761.jpg?v=1671436954</image:loc>
      <image:title>White Plain Premium Jam Cotton Fabric</image:title>
      <image:caption>white-high-quality-jam-cotton</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dyeable-pure-georgette-with-double-sided-banarasi-satin-border</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-23-10-39-39_product_1_1648012179189.jpg?v=1648012238</image:loc>
      <image:title>White Plain Dyeable Pure Georgette fabric with Double Sided Banarasi Satin Border</image:title>
      <image:caption>dyeable-pure-georgette-with-double-sided-banarasi-satin-border</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/teardropdesignerglassbeads01</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/de9ac9a0aec4d951bc42fd0c613272a6.jpg?v=1648115874</image:loc>
      <image:title>Blue Golden Tear Drop Designer Glass Beads</image:title>
      <image:caption>teardropdesignerglassbeads01</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/teardropdesignerglassbeads02</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9914fbdf2cadf51c099aa407bbb48353.jpg?v=1648115898</image:loc>
      <image:title>Green Golden Tear Drop Designer Glass Beads</image:title>
      <image:caption>teardropdesignerglassbeads02</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cylindricalpipedesignerglassbeads01</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/428c4acc62667342c5b53c1149241f51_68caf6f3-d643-4275-b8a3-01477ddc5718.jpg?v=1648017564</image:loc>
      <image:title>Light Blue Cylindrical Pipe Designer Glass Beads</image:title>
      <image:caption>cylindricalpipedesignerglassbeads01</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cylindricalpipedesignerglassbeads03</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/4826cea250686accf9ea7ddcbf5dd5e2_93999f1c-6b1b-4985-935a-29a9592c19b8.jpg?v=1648017612</image:loc>
      <image:title>Yellow Cylindrical Pipe Designer Glass Beads</image:title>
      <image:caption>cylindricalpipedesignerglassbeads03</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cylindricalpipedesignerglassbeads04</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/93d4aedce434a7ba6322c4f364dd725f_f4fd859a-de2b-4ff2-8592-056048c2b315.jpg?v=1648017635</image:loc>
      <image:title>Blue Cylindrical Pipe Designer Glass Beads</image:title>
      <image:caption>cylindricalpipedesignerglassbeads04</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cylindricalpipedesignerglassbeads05</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9eac19f7fc639072ea70cdc6d72bbf26_150a0eb0-98b5-49b3-9433-e870727487e6.jpg?v=1648017657</image:loc>
      <image:title>White Cylindrical Pipe Designer Glass Beads</image:title>
      <image:caption>cylindricalpipedesignerglassbeads05</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dropdesignerglassbeads01</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9c08e0ee425ec017ab33fbd396978d9b_5b489202-095f-4546-ab42-aba6d08ce250.jpg?v=1648017791</image:loc>
      <image:title>Green Drop Designer Glass Beads</image:title>
      <image:caption>dropdesignerglassbeads01</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dropdesignerglassbeads02</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/79cc361aa112711b11c0a45db90f6022_452543a8-4af7-42a3-9f70-e19c886d76df.jpg?v=1648017766</image:loc>
      <image:title>White Drop Designer Glass Beads</image:title>
      <image:caption>dropdesignerglassbeads02</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dropdesignerglassbeads03</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cfd3c9182664d79fb30b2c24ad763021_99e5512c-5427-48d1-a20b-cc5a5921d543.jpg?v=1648017810</image:loc>
      <image:title>Black Drop Designer Glass Beads</image:title>
      <image:caption>dropdesignerglassbeads03</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dropdesignerglassbeads04</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/28bad493884e653b39b3bf6a62ff75f5_3bab289d-ec03-4bba-bbae-43883fbdc25c.jpg?v=1648017835</image:loc>
      <image:title>Light Brown Drop Designer Glass Beads</image:title>
      <image:caption>dropdesignerglassbeads04</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/hexagonaldesignerglassbeads07</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/fc3c47785bfd474ccc8e19fbc52052ce_9005d0f8-1602-4a90-a212-700375bbe552.jpg?v=1648018164</image:loc>
      <image:title>White Hexagonal Designer Glass Beads</image:title>
      <image:caption>hexagonaldesignerglassbeads07</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dyeable-german-cotton-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-9-31-54_product_2_1648094514917.jpg?v=1671436915</image:loc>
      <image:title>White Plain Dyeable German Cotton Silk Fabric</image:title>
      <image:caption>dyeable-german-cotton-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-51</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-10-22-57_product_1_1648097577219.jpg?v=1648097592</image:loc>
      <image:title>Maroon Oval Fancy Czech Glass Beads- 5x7 mm</image:title>
      <image:caption>fancy-glass-beads-51</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-52</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-10-26-37_product_1_1648097797293.jpg?v=1648097809</image:loc>
      <image:title>Maroon Faceted Oval Fancy Czech Glass Beads- 7x9 mm</image:title>
      <image:caption>fancy-glass-beads-52</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-89</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-10-29-20_product_1_1648097960010.jpg?v=1648097972</image:loc>
      <image:title>Orange Flat Circular Fancy Czech Glass Beads- 8x5 mm</image:title>
      <image:caption>fancy-glass-beads-89</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-bead-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-10-31-41_product_1_1648098101717.jpg?v=1648098113</image:loc>
      <image:title>Sky Blue Circular Fancy Czech Glass Beads- 6 mm</image:title>
      <image:caption>fancy-glass-bead-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-99</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-10-38-18_product_1_1648098498796.jpg?v=1648098513</image:loc>
      <image:title>Teal Green Bicone Fancy Czech Glass Beads- 6x6 mm</image:title>
      <image:caption>fancy-glass-beads-99</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-100</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-10-40-27_product_1_1648098627240.jpg?v=1648098639</image:loc>
      <image:title>Blue Faceted Oval Fancy Czech Glass Beads- 4x5 mm</image:title>
      <image:caption>fancy-glass-beads-100</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-102</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-10-47-2_product_1_1648099022162.jpg?v=1648099037</image:loc>
      <image:title>Light Purple Cuboidal Fancy Czech Glass Beads- 6x7 mm</image:title>
      <image:caption>fancy-glass-beads-102</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-103</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-10-49-47_product_1_1648099187846.jpg?v=1648099200</image:loc>
      <image:title>Light Blue Circular Fancy Czech Glass Beads- 4 mm</image:title>
      <image:caption>fancy-glass-beads-103</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-104</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-10-59-23_product_1_1648099763178.jpg?v=1648099777</image:loc>
      <image:title>Purple Faceted Oval Fancy Czech Glass Beads- 6x9 mm</image:title>
      <image:caption>fancy-glass-beads-104</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-106</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-11-3-7_product_1_1648099987557.jpg?v=1648100000</image:loc>
      <image:title>Maroon Flat Oval Fancy Czech Glass Beads- 6x10 mm</image:title>
      <image:caption>fancy-glass-beads-106</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-107</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-11-4-43_product_1_1648100083969.jpg?v=1648100100</image:loc>
      <image:title>Sky Blue Circular Fancy Czech Glass Beads- 8 mm</image:title>
      <image:caption>fancy-glass-beads-107</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-108</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-11-14-45_product_1_1648100685046.jpg?v=1648100696</image:loc>
      <image:title>Purple Oval Fancy Czech Glass Beads- 8x12 mm</image:title>
      <image:caption>fancy-glass-beads-108</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-109</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-11-20-13_product_1_1648101013546.jpg?v=1648101026</image:loc>
      <image:title>Gray Faceted Circular Fancy Czech Glass Beads- 8 mm</image:title>
      <image:caption>fancy-glass-beads-109</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-110</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-11-24-4_product_1_1648101244594.jpg?v=1648101256</image:loc>
      <image:title>Brown Drop Fancy Czech Glass Beads- 5x7 mm</image:title>
      <image:caption>fancy-glass-beads-110</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-111</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-11-36-40_product_1_1648102000005.jpg?v=1648102012</image:loc>
      <image:title>White Circular Ring Fancy Czech Glass Beads- 4x6 mm</image:title>
      <image:caption>fancy-glass-beads-111</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-112</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-11-43-6_product_1_1648102386866.jpg?v=1648102402</image:loc>
      <image:title>Gray Flat Circular Fancy Czech Glass Beads- 4x6 mm</image:title>
      <image:caption>fancy-glass-beads-112</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-113</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-11-44-46_product_1_1648102486376.jpg?v=1648102497</image:loc>
      <image:title>Light Sky Blue Oval Fancy Czech Glass Beads- 5x7 mm</image:title>
      <image:caption>fancy-glass-beads-113</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-114</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-11-47-18_product_1_1648102638866.jpg?v=1648102651</image:loc>
      <image:title>Purple Oval Fancy Czech Glass Beads- 6x10 mm</image:title>
      <image:caption>fancy-glass-beads-114</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-115</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-11-54-24_product_1_1648103064649.jpg?v=1648103077</image:loc>
      <image:title>Red Faceted Circular Fancy Czech Glass Beads- 8 mm</image:title>
      <image:caption>fancy-glass-beads-115</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-117</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-12-9-41_product_1_1648103981305.jpg?v=1648103994</image:loc>
      <image:title>Mustard Yellow Cuboidal Fancy Czech Glass Beads- 6x7 mm</image:title>
      <image:caption>fancy-glass-beads-117</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-bead-5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-12-11-43_product_1_1648104103939.jpg?v=1648104117</image:loc>
      <image:title>Light Purple Oval Fancy Czech Glass Beads- 7x9 mm</image:title>
      <image:caption>fancy-glass-bead-5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-118</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-12-14-47_product_1_1648104287343.jpg?v=1648104299</image:loc>
      <image:title>Dark Blue Flat Circular Fancy Czech Glass Beads- 5 mm</image:title>
      <image:caption>fancy-glass-beads-118</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-119</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-12-17-59_product_1_1648104479428.jpg?v=1648104490</image:loc>
      <image:title>White Fancy Cylindrical Fancy Czech Glass Beads- 18x25 mm</image:title>
      <image:caption>fancy-glass-beads-119</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-120</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-12-28-2_product_1_1648105082586.jpg?v=1648105092</image:loc>
      <image:title>Gray Drop Fancy Czech Glass Beads- 5x7 mm</image:title>
      <image:caption>fancy-glass-beads-120</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-121</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-12-30-23_product_1_1648105223922.jpg?v=1648105235</image:loc>
      <image:title>Gray Cuboidal Fancy Czech Glass Beads- 6x7 mm</image:title>
      <image:caption>fancy-glass-beads-121</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-122</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-12-32-32_product_1_1648105352463.jpg?v=1648105364</image:loc>
      <image:title>Gray Heart Fancy Czech Glass Beads- 6x6 mm</image:title>
      <image:caption>fancy-glass-beads-122</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-123</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-12-34-12_product_1_1648105452977.jpg?v=1648105466</image:loc>
      <image:title>Dark Gray Flat Circular Fancy Czech Glass Beads- 6x8 mm</image:title>
      <image:caption>fancy-glass-beads-123</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-124</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-12-35-52_product_1_1648105552676.jpg?v=1648105568</image:loc>
      <image:title>Yellow Faceted Oval Fancy Czech Glass Beads- 6x9 mm</image:title>
      <image:caption>fancy-glass-beads-124</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-126</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-13-10-21_product_1_1648107621784.jpg?v=1648107639</image:loc>
      <image:title>Light Pink Flat Circular Fancy Czech Glass Beads- 4x6 mm</image:title>
      <image:caption>fancy-glass-beads-126</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-127</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-24-13-12-13_product_1_1648107733920.jpg?v=1648107750</image:loc>
      <image:title>Red Flat Circular Fancy Czech Glass Beads- 8 mm</image:title>
      <image:caption>fancy-glass-beads-127</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/teardropdesignerglassbeads04</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/4c9a8d907213b1e547f31ce42ae9f965_c8aab13b-3866-40ed-a17b-b434013d01ce.jpg?v=1648115951</image:loc>
      <image:title>Green Golden Tear Drop Designer Glass Beads</image:title>
      <image:caption>teardropdesignerglassbeads04</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/stonestuddedmetalliccharms001</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/B_2.jpg?v=1648205976</image:loc>
      <image:title>White &apos;B&apos; Stone Studded Metallic Charms</image:title>
      <image:caption>stonestuddedmetalliccharms001</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/stonestuddedmetalliccharms002</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/C_1.jpg?v=1648205944</image:loc>
      <image:title>White &apos;C&apos; Stone Studded Metallic Charms</image:title>
      <image:caption>stonestuddedmetalliccharms002</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/stonestuddedmetalliccharms003</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/845c9919e28d202998ebafc84d999efb.jpg?v=1648119003</image:loc>
      <image:title>White &apos;D&apos; Stone Studded Metallic Charms</image:title>
      <image:caption>stonestuddedmetalliccharms003</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/stonestuddedmetalliccharms004</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/09c64d41dd8c5d58c68679d5571792cb.jpg?v=1648119024</image:loc>
      <image:title>White &apos;E&apos; Stone Studded Metallic Charms</image:title>
      <image:caption>stonestuddedmetalliccharms004</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/stonestuddedmetalliccharms005</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/81aaa33591e5d94686044edfc5b021a0.jpg?v=1648119053</image:loc>
      <image:title>White &apos;F&apos; Stone Studded Metallic Charms</image:title>
      <image:caption>stonestuddedmetalliccharms005</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/stonestuddedmetalliccharms006</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/228fbe1574da172f0eefc9537cdb9e47.jpg?v=1648119083</image:loc>
      <image:title>White &apos;G&apos; Stone Studded Metallic Charms</image:title>
      <image:caption>stonestuddedmetalliccharms006</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/stonestuddedmetalliccharms007</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/7309d282d1c34e3a68ae028f0f54d543.jpg?v=1648119115</image:loc>
      <image:title>White &apos;H&apos; Stone Studded Metallic Charms</image:title>
      <image:caption>stonestuddedmetalliccharms007</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/stonestuddedmetalliccharms008</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/675776c693f11bb22af34449466ede73.jpg?v=1648119139</image:loc>
      <image:title>White &apos;I&apos; Stone Studded Metallic Charms</image:title>
      <image:caption>stonestuddedmetalliccharms008</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/stonestuddedmetalliccharms009</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c2670edeac9379328d0b8268be051b36.jpg?v=1648119152</image:loc>
      <image:title>White &apos;J&apos; Stone Studded Metallic Charms</image:title>
      <image:caption>stonestuddedmetalliccharms009</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/stonestuddedmetalliccharms010</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2247dbb042ece7fa8cc3dbe49446f24d.jpg?v=1648119175</image:loc>
      <image:title>White &apos;K&apos; Stone Studded Metallic Charms</image:title>
      <image:caption>stonestuddedmetalliccharms010</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/stonestuddedmetalliccharms011</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9d45ccc37bcde8769fc077c8abc029f7.jpg?v=1648119236</image:loc>
      <image:title>White &apos;L&apos; Stone Studded Metallic Charms</image:title>
      <image:caption>stonestuddedmetalliccharms011</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/stonestuddedmetalliccharms012</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/M_3.jpg?v=1648205656</image:loc>
      <image:title>White &apos;M&apos; Stone Studded Metallic Charms</image:title>
      <image:caption>stonestuddedmetalliccharms012</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/stonestuddedmetalliccharms013</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Q_2.jpg?v=1648205618</image:loc>
      <image:title>White &apos;Q&apos; Stone Studded Metallic Charms</image:title>
      <image:caption>stonestuddedmetalliccharms013</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/stonestuddedmetalliccharms014</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/R_2.jpg?v=1648205583</image:loc>
      <image:title>White &apos;R&apos; Stone Studded Metallic Charms</image:title>
      <image:caption>stonestuddedmetalliccharms014</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/stonestuddedmetalliccharms015</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/V_1.jpg?v=1648205546</image:loc>
      <image:title>White &apos;V&apos; Stone Studded Metallic Charms</image:title>
      <image:caption>stonestuddedmetalliccharms015</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/stonestuddedmetalliccharms016</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/W_2.jpg?v=1648205507</image:loc>
      <image:title>White &apos;W&apos; Stone Studded Metallic Charms</image:title>
      <image:caption>stonestuddedmetalliccharms016</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/stonestuddedmetalliccharms017</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/X_2.jpg?v=1648205280</image:loc>
      <image:title>White &apos;X&apos; Stone Studded Metallic Charms</image:title>
      <image:caption>stonestuddedmetalliccharms017</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/stonestuddedmetalliccharms018</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Y_3.jpg?v=1648205204</image:loc>
      <image:title>White &apos;Y&apos; Stone Studded Metallic Charms</image:title>
      <image:caption>stonestuddedmetalliccharms018</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/stonestuddedmetalliccharms019</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Z_1.jpg?v=1648204214</image:loc>
      <image:title>White &apos;Z&apos; Stone Studded Metallic Charms</image:title>
      <image:caption>stonestuddedmetalliccharms019</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-golden-designer-glass-cup-chains-7-ss-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Light_Golden_Designer_Glass_Cup_Chains_-_7_ss_product_1_1615357538856_4b763969-341d-4c78-b9ed-f1e3c666fd21.jpg?v=1648538296</image:loc>
      <image:title>Light Golden Designer Glass Cup Chains - 7 ss</image:title>
      <image:caption>light-golden-designer-glass-cup-chains-7-ss</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-purple-designer-closed-glass-cup-chains-12-ss-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Light_Purple_Designer_Closed_Glass_Cup_Chains_-_12_ss_product_1_1615357712056_0c2637a2-a342-4aab-92d4-e85cc0d7467f.jpg?v=1648538538</image:loc>
      <image:title>Light Purple Designer Closed Glass Cup Chains - 12 ss</image:title>
      <image:caption>light-purple-designer-closed-glass-cup-chains-12-ss</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-circular-agate-stones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/80_c9b8c58b-52a5-4bad-bb2f-94f22754cf79.jpg?v=1648724638</image:loc>
      <image:title>Yellow Circular Agate Stones</image:title>
      <image:caption>Yellow Circular Agate Stones | The Design Cart (4333695369285)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-circular-agate-stones-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/80_89149915-12b0-45a1-a857-04837d5e9c69.jpg?v=1648724947</image:loc>
      <image:title>Yellow Circular Agate Stones</image:title>
      <image:caption>Yellow Circular Agate Stones | The Design Cart (4333695369285)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/attractive-flower-bouquet-design-brooch-for-men-and-women</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-31-23-55-35_product_1_1648805135061.jpg?v=1648751117</image:loc>
      <image:title>Yellow Flower Designer Brooch</image:title>
      <image:caption>attractive-flower-bouquet-design-brooch-for-men-and-women</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/attractive-flower-bouquet-design-brooch-for-men-and-women-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-3-31-23-59-23_product_1_1648805363707.jpg?v=1648751348</image:loc>
      <image:title>Red Flower Designer Brooch</image:title>
      <image:caption>attractive-flower-bouquet-design-brooch-for-men-and-women-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/attractive-flower-bouquet-design-brooch-for-men-and-women-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-1-0-3-54_product_1_1648805634527.jpg?v=1648751621</image:loc>
      <image:title>Blue Flower Designer Brooch</image:title>
      <image:caption>attractive-flower-bouquet-design-brooch-for-men-and-women-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/attractive-flower-bouquet-design-brooch-for-men-and-women-3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-1-0-36-34_product_1_1648807594370.jpg?v=1648753580</image:loc>
      <image:title>White Flower Designer Brooch</image:title>
      <image:caption>attractive-flower-bouquet-design-brooch-for-men-and-women-3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/olive-white-floral-printed-pure-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-1-14-32-10_product_1_1648803730702.jpg?v=1754478773</image:loc>
      <image:title>Olive Green White Floral Printed Pure Cotton Fabric</image:title>
      <image:caption>olive-white-floral-printed-pure-cotton-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons001</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/122b0efb16cca97ca62117658a33b64c.jpg?v=1648815330</image:loc>
      <image:title>Green Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons001</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons002</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/ea916cbe55a196529c24c5eac85191a0.jpg?v=1648815366</image:loc>
      <image:title>Orange Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons002</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons003</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/b4a53af97cd0a50077987cf151339a5c.jpg?v=1648815399</image:loc>
      <image:title>Gray Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons003</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons004</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/12f32008a32cfea05b963f08dc7e5f04.jpg?v=1648815435</image:loc>
      <image:title>Pink Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons004</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons005</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d9873fac6c368091b39ef2c71566b402.jpg?v=1648815468</image:loc>
      <image:title>Bright Blue Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons005</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons006</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/246c40ce51c5efaaa41c88830a203d37.jpg?v=1648815501</image:loc>
      <image:title>Purple Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons006</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons007</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/118252858b1e953fbbca6d690137cc7d.jpg?v=1648815537</image:loc>
      <image:title>Deep Pink Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons007</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons008</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d07ab69318f1ce4debf0deee9842cd0d.jpg?v=1648815601</image:loc>
      <image:title>Coral Pink Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons008</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons009</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/27bc25344dc482916e3e96a1c1c8f1db.jpg?v=1648815634</image:loc>
      <image:title>Red Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons009</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons010</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/ce2d00808dfdd6062d63e409fd3ccf85.jpg?v=1648815668</image:loc>
      <image:title>Blue Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons010</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons011</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/698caa6678fb819c6509d66de3345302.jpg?v=1648815704</image:loc>
      <image:title>Mustard Yellow Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons011</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons012</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/86e73792196daeed980e4f8534865a18.jpg?v=1648815740</image:loc>
      <image:title>Bright Blue Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons012</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons013</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/f01ea88f8ea11481338c686293c44a7a.jpg?v=1648815774</image:loc>
      <image:title>White Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons013</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons014</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/b7d9a0c462856d35bc8983f4d77182e6.jpg?v=1648815809</image:loc>
      <image:title>Light Yellow Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons014</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons015</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d367eabcc0142c3a4032238a3e505110.jpg?v=1648815876</image:loc>
      <image:title>Light Brown Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons015</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons016</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a76d630ac6f15ccc29777a65216abdfa.jpg?v=1648815912</image:loc>
      <image:title>Brown Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons016</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons017</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c9889fae1792d2d7be95f3b65789f151_91c05f28-6ecc-4038-8b2f-ea64829cc32e.jpg?v=1648815948</image:loc>
      <image:title>Yellow Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons017</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons018</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/44ba8453290cd621659f8fd0b60725a8.jpg?v=1648815983</image:loc>
      <image:title>Maroon Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons018</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons019</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/4376075e8153d3f76d59fca02c2ec67e.jpg?v=1648816017</image:loc>
      <image:title>Deep Pink Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons019</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons020</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/be05aaee15654021c0d3f40c42b3eccb.jpg?v=1648816052</image:loc>
      <image:title>Dark Brown Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons020</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons021</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/dca3b59cf67ee251b6f7ed600283ad82.jpg?v=1648816116</image:loc>
      <image:title>Light Orange Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons021</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons022</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cb01b1d9644246559821a32d0cf92103.jpg?v=1648816149</image:loc>
      <image:title>Green Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons022</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons023</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cf8fe69d96a78064a4b452a29125934a.jpg?v=1648816184</image:loc>
      <image:title>Teal Blue Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons023</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalplasticbuttons024</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/eccf39d2616235b408c56ba954afdd1f.jpg?v=1648816218</image:loc>
      <image:title>Black Oval Plastic Buttons</image:title>
      <image:caption>ovalplasticbuttons024</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundgranularacrylicbuttons1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/7e996b0d18b19c55e3b949ec08cb57f0_11f9d129-d67f-4895-9c96-8a673b1058a9.jpg?v=1648816661</image:loc>
      <image:title>Dark Gray Round Granular Acrylic Buttons</image:title>
      <image:caption>roundgranularacrylicbuttons1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundgranularacrylicbuttons2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/283af1b3b8400aca182c03720e5bfebd_90288dbd-76e0-43a3-838b-f52a44b7b350.jpg?v=1648816696</image:loc>
      <image:title>Maroon Round Granular Acrylic Buttons</image:title>
      <image:caption>roundgranularacrylicbuttons2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundgranularacrylicbuttons4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c3491f124b256bd62c435f31cb1fa04b_0bf72943-96f4-429f-bfd5-c2f9fd8ba51e.jpg?v=1648816768</image:loc>
      <image:title>Green Round Granular Acrylic Buttons</image:title>
      <image:caption>roundgranularacrylicbuttons4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundgranularacrylicbuttons5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/68c3aa90030ec85abed4869e6f87f972_f24278fd-fb45-4bed-a870-982f300bf28f.jpg?v=1648816805</image:loc>
      <image:title>Mustard Yellow Round Granular Acrylic Buttons</image:title>
      <image:caption>roundgranularacrylicbuttons5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundgranularacrylicbuttons6</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/8b612fd69bbfb338e6f3ad009286a60a_1cf6a790-fe07-4167-9f0f-9b7bf9065e87.jpg?v=1648816840</image:loc>
      <image:title>Light Brown Round Granular Acrylic Buttons</image:title>
      <image:caption>roundgranularacrylicbuttons6</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundgranularacrylicbuttons7</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/7bd252cdb283d7cc490cc6093a429d12_fcfa08ba-2aec-4d53-901a-310d8269036d.jpg?v=1648816875</image:loc>
      <image:title>Black Round Granular Acrylic Buttons</image:title>
      <image:caption>roundgranularacrylicbuttons7</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundgranularacrylicbuttons8</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/3987633b72f6a0b3eb5c2d68ba318b83_0c0db626-992e-4d4b-970e-b65282b29d86.jpg?v=1648816944</image:loc>
      <image:title>Light Orange Round Granular Acrylic Buttons</image:title>
      <image:caption>roundgranularacrylicbuttons8</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundgranularacrylicbuttons9</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c529053b9d67a9c32a9c27ad24a52ba8_3a7094d5-7abc-4700-90ce-779fce1d52ea.jpg?v=1648816978</image:loc>
      <image:title>Light Pink Round Granular Acrylic Buttons</image:title>
      <image:caption>roundgranularacrylicbuttons9</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/olive-yellow-floral-printed-pure-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-1-20-10-40_product_1_1648824040368.jpg?v=1648824048</image:loc>
      <image:title>Olive Yellow Floral Printed Pure Cotton Fabric</image:title>
      <image:caption>olive-yellow-floral-printed-pure-cotton-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/stonestuddedmetalliccharms021</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/7f7528da8fb28a8d17c63bd811816579.jpg?v=1648886110</image:loc>
      <image:title>White &apos;N&apos; Stone Studded Metallic Charms</image:title>
      <image:caption>stonestuddedmetalliccharms021</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/stonestuddedmetalliccharms022</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/beb7787aef5d35bdfd4d329671d4180f.jpg?v=1648886226</image:loc>
      <image:title>White &apos;P&apos; Stone Studded Metallic Charms</image:title>
      <image:caption>stonestuddedmetalliccharms022</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/stonestuddedmetalliccharms024</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/5488cdaffaee0864a841dbf8f93445d3.jpg?v=1648886382</image:loc>
      <image:title>White &apos;T&apos; Stone Studded Metallic Charms</image:title>
      <image:caption>stonestuddedmetalliccharms024</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/stonestuddedmetalliccharms025</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/47890705af87391b42cffb5a008306fc.jpg?v=1648886496</image:loc>
      <image:title>White &apos;U&apos; Stone Studded Metallic Charms</image:title>
      <image:caption>stonestuddedmetalliccharms025</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/parrot-green-chanderi-with-embroidered-white-lakhnawi-motifs</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-4-14-42-25_product_1_1649063545396.jpg?v=1649063555</image:loc>
      <image:title>Parrot Green White Lakhnawi Motifs Embroidered Chanderi Fabric</image:title>
      <image:caption>parrot-green-chanderi-with-embroidered-white-lakhnawi-motifs</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/grey-sequinned-chikanari-rayon-fabric-with-one-sided-border</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-4-14-49-47_product_1_1649063987339.jpg?v=1649064002</image:loc>
      <image:title>Gray Sequins Floral Chikankari Rayon Fabric with Border</image:title>
      <image:caption>grey-sequinned-chikanari-rayon-fabric-with-one-sided-border</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/beige-sequins-thread-embroidered-chanderi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-4-14-55-3_product_1_1649064303780.jpg?v=1649064319</image:loc>
      <image:title>Beige Floral Sequins &amp; Thread Embroidered Chanderi Fabric</image:title>
      <image:caption>beige-sequins-thread-embroidered-chanderi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/maroon-golden-sequinned-embroidered-velvet-fabric-with-border</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-4-15-0-0_product_1_1649064600142.jpg?v=1649064680</image:loc>
      <image:title>Maroon Golden Sequins Embroidered Velvet Fabric</image:title>
      <image:caption>maroon-golden-sequinned-embroidered-velvet-fabric-with-border</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/sage-green-plain-satin-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-4-15-4-3_product_1_1649064843928.jpg?v=1649064853</image:loc>
      <image:title>Sage Green Plain Satin Fabric</image:title>
      <image:caption>sage-green-plain-satin-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/mustard-silver-mirror-work-heavy-embroidered-satin-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-5-14-31-14_product_1_1649149274976.jpg?v=1649149288</image:loc>
      <image:title>Mustard Silver Geometric Mirror Work Embroidered Satin Fabric</image:title>
      <image:caption>mustard-silver-mirror-work-heavy-embroidered-satin-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/sky-blue-multicolored-printed-muslin-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-6-12-5-35_product_1_1649226935274.jpg?v=1649226959</image:loc>
      <image:title>Sky Blue Multicolour Flowers Printed Muslin Cotton Fabric</image:title>
      <image:caption>sky-blue-multicolored-printed-muslin-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-dori-stone-pearl-embellished-handwork-patches</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-6-12-15-50_product_1_1649227550621.jpg?v=1649227577</image:loc>
      <image:title>Golden Dori Stone &amp; Pearl Embellished Handwork Patches</image:title>
      <image:caption>golden-dori-stone-pearl-embellished-handwork-patches</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/antique-golden-lion-metal-coat-buttons-set-of-13-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-8-9-37-1_product_1_1649444821877.jpg?v=1757865580</image:loc>
      <image:title>Antique Golden Lion Metal Coat Buttons</image:title>
      <image:caption>antique-golden-lion-metal-coat-buttons-set-of-13-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/meenakari-design-metal-buttons-in-multicolor-set-of-13-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-8-9-52-7_product_1_1649445727459.jpg?v=1766559338</image:loc>
      <image:title>Multicolour Meenakari Design Metal Buttons</image:title>
      <image:caption>meenakari-design-metal-buttons-in-multicolor-set-of-13-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/awesome-gold-color-tiger-shape-brooch-for-men-and-women</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-8-11-58-48_product_1_1649399328358.jpg?v=1757865552</image:loc>
      <image:title>Golden Tiger Designer Brooch</image:title>
      <image:caption>awesome-gold-color-tiger-shape-brooch-for-men-and-women</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-dots-golden-yellow-viscose-muslin-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-8-12-44-17_product_1_1649402057723.jpg?v=1649402063</image:loc>
      <image:title>Golden Yellow White Floral Motifs Viscose Muslin Silk Fabric</image:title>
      <image:caption>white-dots-golden-yellow-viscose-muslin-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-dots-green-viscose-muslin-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-8-12-47-15_product_1_1649402235937.jpg?v=1649402241</image:loc>
      <image:title>Green White Geometric Viscose Muslin Silk Fabric</image:title>
      <image:caption>white-dots-green-viscose-muslin-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/metallicjewelrycharms23</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/e9a81bdce745f2a36c7ffc4fd26a20b6_2da608a5-fe1c-407c-8ed3-c36f28dee5b8.jpg?v=1649766109</image:loc>
      <image:title>Silver Rectangular Metallic Jewelry Charms</image:title>
      <image:caption>metallicjewelrycharms23</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/metallicjewelrycharms24</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c4e35b098f8b594037228356e64eab71_d1f89bfb-6fae-4105-9d26-2a5ffc0ad9c1.jpg?v=1649766144</image:loc>
      <image:title>Silver Designer Metallic Jewelry Charms</image:title>
      <image:caption>metallicjewelrycharms24</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/metallicjewelrycharms25</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/193cd6cb4890113deca6d3ba6f62dffb_ea9ff89f-8e1d-4ba9-96fc-6d0403c6b2f2.jpg?v=1649766181</image:loc>
      <image:title>Silver Floral Metallic Jewelry Charms</image:title>
      <image:caption>metallicjewelrycharms25</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/metallicjewelrycharms27</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/3aefc9dc0ff96f8f6673d8578a06e42b_26b7e96b-76a5-4e56-abd3-189bf108f3d6.jpg?v=1649766251</image:loc>
      <image:title>Silver Circular Metallic Jewelry Charms</image:title>
      <image:caption>metallicjewelrycharms27</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/metallicjewelrycharms28</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/ae013ffedbefa31e77f2d76de4d9a411_a7d3e527-60f7-40af-92b8-11f45fd7b244.jpg?v=1649766287</image:loc>
      <image:title>Silver Triangular Metallic Jewelry Charms</image:title>
      <image:caption>metallicjewelrycharms28</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/metallicjewelrycharms44</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/b808d2a46f3918fdb223eae3c897a960_e3012269-6cc0-483e-9f01-7660f3f7079c.jpg?v=1649766918</image:loc>
      <image:title>Orange Pumpkin Metallic Jewelry Charms</image:title>
      <image:caption>metallicjewelrycharms44</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/metallicjewelrycharms53</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/725e3b88ed64af4911f29c8065bdde2e.jpg?v=1649765567</image:loc>
      <image:title>Blue Owl Metallic Jewelry Charms</image:title>
      <image:caption>metallicjewelrycharms53</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/metallicjewelrycharms55</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1432a8991da821a679148f3568717095.jpg?v=1649765640</image:loc>
      <image:title>Red Owl Metallic Jewelry Charms</image:title>
      <image:caption>metallicjewelrycharms55</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/metallicjewelrycharms56</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/4c2f28971b217990d53258caa4de4f10.jpg?v=1649765673</image:loc>
      <image:title>Pink Owl Metallic Jewelry Charms</image:title>
      <image:caption>metallicjewelrycharms56</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/metallicjewelrycharms59</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/4087b8560ddab710db8133dca411d808.jpg?v=1649765775</image:loc>
      <image:title>Dark Green Smiley Metallic Jewelry Charms</image:title>
      <image:caption>metallicjewelrycharms59</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/metallicjewelrycharms61</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9628c487132a5716cb1cee703f7cbc5e.jpg?v=1649765841</image:loc>
      <image:title>Pink Smiley Metallic Jewelry Charms</image:title>
      <image:caption>metallicjewelrycharms61</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/metallicjewelrycharms62</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c9974668d157a4f8b896cc65221e01a6.jpg?v=1649765900</image:loc>
      <image:title>Green Smiley Metallic Jewelry Charms</image:title>
      <image:caption>metallicjewelrycharms62</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/metallicjewelrycharms63</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/fe3e11ef8340944e9e788921325f7efa.jpg?v=1649765928</image:loc>
      <image:title>Blue Smiley Metallic Jewelry Charms</image:title>
      <image:caption>metallicjewelrycharms63</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/metallicjewelrycharms65</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a14cdecb856b3dd14941df5f599cca5c.jpg?v=1649765986</image:loc>
      <image:title>Dark Green Metallic Jewelry Charms</image:title>
      <image:caption>metallicjewelrycharms65</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ringspringclasps68</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9866869c7d1727d48491e942f77e6c97.jpg?v=1649766079</image:loc>
      <image:title>Silver Ring Spring Clasps</image:title>
      <image:caption>ringspringclasps68</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/metalliclobsterclasps72</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d7e4274987a5c020ff49beec5a4dbdbd.jpg?v=1649766227</image:loc>
      <image:title>Golden Metallic Lobster Clasps</image:title>
      <image:caption>metalliclobsterclasps72</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/metalliclobsterclasps73</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/15cde907eafda1b091e4e22b0c5adb54.jpg?v=1649766259</image:loc>
      <image:title>Silver Metallic Lobster Clasps</image:title>
      <image:caption>metalliclobsterclasps73</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ringspringclasps75</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/744794f317a6ede0c4b35b7d6124a076.jpg?v=1649766321</image:loc>
      <image:title>Silver Ring Spring Clasps</image:title>
      <image:caption>ringspringclasps75</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ringspringclasps76</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/bb8786351020289174e86ba8b9fbf4bc.jpg?v=1649766350</image:loc>
      <image:title>Golden Ring Spring Clasps</image:title>
      <image:caption>ringspringclasps76</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ringspringclasps77</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/8a6a7ffef690292910e3a32a1188aac4.jpg?v=1649766381</image:loc>
      <image:title>Dark Golden Ring Spring Clasps</image:title>
      <image:caption>ringspringclasps77</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/metalliccharm90</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/21d5e9b5cb454ba1d3d45e4d313bc271.jpg?v=1649766820</image:loc>
      <image:title>Black Fancy Metallic Jewelry Charms</image:title>
      <image:caption>metalliccharm90</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/metallicfishclasps91</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/7fea7fc55299a28f69ff7556ca3411a6.jpg?v=1649766852</image:loc>
      <image:title>Silver Metallic Fish Clasps</image:title>
      <image:caption>metallicfishclasps91</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/metallicfishclasps92</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/bd2a3fe48f3b32d9c7ba9bb734c3792f.jpg?v=1649766919</image:loc>
      <image:title>Silver Metallic Fish Clasps</image:title>
      <image:caption>metallicfishclasps92</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/circularfabricbuttons93</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2d249f9712e5f9335a137b6fed971609.jpg?v=1649766954</image:loc>
      <image:title>Red Circular Fabric Buttons</image:title>
      <image:caption>circularfabricbuttons93</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/circularfabricbuttons97</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/16d38537f460383fc68dcd2f4351a182.jpg?v=1649767074</image:loc>
      <image:title>Black Circular Fabric Buttons</image:title>
      <image:caption>circularfabricbuttons97</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/metalliccharm103</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/0bcbea651b0b88c9cf438a49db77889c.jpg?v=1649767286</image:loc>
      <image:title>Silver Gold Eye Metallic Jewelry Charms</image:title>
      <image:caption>metalliccharm103</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/metalliccharm109</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/969ecdf1ab1c94f9e6e2426a2fff4db8.jpg?v=1649767488</image:loc>
      <image:title>Silver Fancy Metallic Jewelry Charms</image:title>
      <image:caption>metalliccharm109</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/metalliccharm115</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/3d11319a23e7dfb6412a4139a1eabae2.jpg?v=1649767724</image:loc>
      <image:title>Yellow Red Ice Cream Metallic Jewelry Charms</image:title>
      <image:caption>metalliccharm115</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystalcharms122</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/26529ee8ea9d5bb8d5ab917df440ed23.jpg?v=1649767977</image:loc>
      <image:title>Baby Pink Fancy Crystal Charms</image:title>
      <image:caption>crystalcharms122</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/irregularshapedshellbeads149</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/506cf4a1753c6edd706d69be6c152992.jpg?v=1649768353</image:loc>
      <image:title>Blue Cream Uneven Designer Shell Beads</image:title>
      <image:caption>irregularshapedshellbeads149</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/irregularshapedshellbeads150</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/fc64487e4f86b151479c1822116b59d5.jpg?v=1649768394</image:loc>
      <image:title>Cream Uneven Designer Shell Beads</image:title>
      <image:caption>irregularshapedshellbeads150</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/irregularshapedshellbeads151</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/35136ed1645e9da7bf5a361d772888e0.jpg?v=1649768432</image:loc>
      <image:title>Blue Uneven Designer Shell Beads</image:title>
      <image:caption>irregularshapedshellbeads151</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/irregularshapedshellbeads153</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9d2bda25cc9ecc749aff4e60b89c4cdf.jpg?v=1649768464</image:loc>
      <image:title>Dark Brown Uneven Designer Shell Beads</image:title>
      <image:caption>irregularshapedshellbeads153</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/irregularshapedshellbeads154</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1a340debe0fa5cf210267624aa6fb145.jpg?v=1649768496</image:loc>
      <image:title>Off White Uneven Designer Shell Beads</image:title>
      <image:caption>irregularshapedshellbeads154</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/irregularshapedshellbeads155</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/f6c2d5de37d347a2033986e6155b30d7.jpg?v=1649768529</image:loc>
      <image:title>Orange Uneven Designer Shell Beads</image:title>
      <image:caption>irregularshapedshellbeads155</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/irregularshapedshellbeads156</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/92e0640ffe4080c4d1075bee56fb7ae9.jpg?v=1649768590</image:loc>
      <image:title>Red Uneven Designer Shell Beads</image:title>
      <image:caption>irregularshapedshellbeads156</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/irregularshapedshellbeads157</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cb13743dfe75ba5cf5f628502d970f2a.jpg?v=1649768624</image:loc>
      <image:title>Yellow Uneven Designer Shell Beads</image:title>
      <image:caption>irregularshapedshellbeads157</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/facetedflatcrystalbeads168</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/542b917064e3be06fcd456874e690ede.jpg?v=1649768994</image:loc>
      <image:title>White Rainbow Faceted Flat Crystal Beads</image:title>
      <image:caption>facetedflatcrystalbeads168</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/conicalcrystalbeads169</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/062049a579fbcbae9e4a288af1bd0392.jpg?v=1649769055</image:loc>
      <image:title>Silver Conical Crystal Beads</image:title>
      <image:caption>conicalcrystalbeads169</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/conicalcrystalbeads170</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/eeb77a826483640f00840675ad9c51bf.jpg?v=1649769086</image:loc>
      <image:title>Light Brown Conical Crystal Beads</image:title>
      <image:caption>conicalcrystalbeads170</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/conicalcrystalbeads171</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cbd75bed1659c2669e840ecefc972b91.jpg?v=1649769119</image:loc>
      <image:title>White Rainbow Conical Crystal Beads</image:title>
      <image:caption>conicalcrystalbeads171</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/smoothrondelletyreglassbeads172</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/308c4f34d53047b8ada6a7dd3ebc13b0_42c09ff3-309d-45bc-bc04-351ed6a69b74.jpg?v=1649769150</image:loc>
      <image:title>Purple Smooth Rondelle / Tyre Glass Crystal Beads</image:title>
      <image:caption>smoothrondelletyreglassbeads172</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/smoothrondelletyreglassbeads173</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/70ccc0eb51826eb66871ca408c188535_a936005a-5367-4217-bf07-5761cd03a536.jpg?v=1649769174</image:loc>
      <image:title>White Smooth Rondelle / Tyre Glass Crystal Beads</image:title>
      <image:caption>smoothrondelletyreglassbeads173</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/smoothrondelletyreglassbeads174</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d0c217be85803d847115e69bcd865fb0_21e2de3c-b17a-4a37-b4ae-872ca04e015a.jpg?v=1649769202</image:loc>
      <image:title>Blue Smooth Rondelle / Tyre Glass Crystal Beads</image:title>
      <image:caption>smoothrondelletyreglassbeads174</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/smoothrondelletyreglassbeads175</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d11acdd07fbc9f11e144d4da3213a9f7_05cefac2-9615-43f7-9138-2286f854d593.jpg?v=1649769231</image:loc>
      <image:title>Red Smooth Rondelle / Tyre Glass Crystal Beads</image:title>
      <image:caption>smoothrondelletyreglassbeads175</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/smoothrondelletyreglassbeads177</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/18f660d65bf38080bbfbf57a24ce161d_a1e3d289-5650-4e74-a41c-02f5570de828.jpg?v=1649769314</image:loc>
      <image:title>Light Blue Smooth Rondelle / Tyre Glass Crystal Beads</image:title>
      <image:caption>smoothrondelletyreglassbeads177</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/smoothrondelletyreglassbeads178</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1ec00095709557c1269712eba04f71fa_7f224ae6-fe55-4f59-80bf-19a272d0d005.jpg?v=1649769343</image:loc>
      <image:title>Pink Smooth Rondelle / Tyre Glass Crystal Beads</image:title>
      <image:caption>smoothrondelletyreglassbeads178</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/smoothrondelletyreglassbeads179</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/f646d2be140fa2723f19fabb866dd9ce_8400762f-0843-431c-9755-854567aba809.jpg?v=1649769369</image:loc>
      <image:title>Dark Red Smooth Rondelle / Tyre Glass Crystal Beads</image:title>
      <image:caption>smoothrondelletyreglassbeads179</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/smoothrondelletyreglassbeads180</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/e34cccc41abad3bb857eb40baf6b02e4_053f512b-c9f6-4a02-b480-b2a5584cb580.jpg?v=1649769396</image:loc>
      <image:title>Orange Smooth Rondelle / Tyre Glass Crystal Beads</image:title>
      <image:caption>smoothrondelletyreglassbeads180</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/scribbledpearlbeads185</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c5a7c49f6500208b091276c1dcaf1fee.jpg?v=1649769535</image:loc>
      <image:title>Cream Oval Scribbled Pearl Beads</image:title>
      <image:caption>scribbledpearlbeads185</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/scribbledpearlbeads187</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2e391072acb426dcccb37513f15e858b.jpg?v=1649769633</image:loc>
      <image:title>Cream Drop Scribbled Pearl Beads</image:title>
      <image:caption>scribbledpearlbeads187</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/metalliccharm195</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/07a67e5d909036761cfa12ed332cbaf8.jpg?v=1649769839</image:loc>
      <image:title>Light Yellow Leaf Designer Metallic Charms</image:title>
      <image:caption>metalliccharm195</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/metalliccharm197</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c20d86261e0d8419afcdbe92b0e7399c.jpg?v=1649769924</image:loc>
      <image:title>Multicolour Leaf Designer Metallic Charms</image:title>
      <image:caption>metalliccharm197</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/scribbledpearlbeads199</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/b8e7b48df59b6e5d2190dc79d3e779b3.jpg?v=1649769985</image:loc>
      <image:title>Cream Scribbled Pearl Beads</image:title>
      <image:caption>scribbledpearlbeads199</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/beige-chanderi-with-embroidered-leaf-motifs</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-8-19-27-31_product_1_1649426251731.jpg?v=1649426316</image:loc>
      <image:title>Beige Leaf Motifs Embroidered Chanderi Fabric</image:title>
      <image:caption>beige-chanderi-with-embroidered-leaf-motifs</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-multicolored-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-8-19-32-22_product_1_1649426542850.jpg?v=1649426565</image:loc>
      <image:title>White Multicolored Flowers Embroidered Chanderi Fabric</image:title>
      <image:caption>white-multicolored-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dyeable-paisley-lakhnawi-cotton-embroidered-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-8-19-37-54_product_1_1649426874486.jpg?v=1649426893</image:loc>
      <image:title>White Paisleys Lakhnawi Embroidered Dyeable Cotton Fabric</image:title>
      <image:caption>dyeable-paisley-lakhnawi-cotton-embroidered-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-color-lion-metal-coat-buttons-set-of-13-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-8-22-56-51_product_1_1649492811281.jpg?v=1757865478</image:loc>
      <image:title>Silver Lion Unique Design Metal Coat Buttons</image:title>
      <image:caption>silver-color-lion-metal-coat-buttons-set-of-13-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-navy-cotton-plaid-check-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/img_20240822_132202.jpg?v=1748934306</image:loc>
      <image:title>Wine &amp; Gray Checks Cotton Plaid Fabric</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dyeable-floral-chikankari-embroidered-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-9-14-11-45_product_1_1649493705584.jpg?v=1649493891</image:loc>
      <image:title>White Dyeable Floral Chikankari Embroidered Cotton Fabric</image:title>
      <image:caption>dyeable-floral-chikankari-embroidered-cotton-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-chanderi-silk-with-embroidered-black-lakhnawi-jaal</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-9-14-25-58_product_1_1649494558736.jpg?v=1649494600</image:loc>
      <image:title>White Black Lakhnawi Flowers Embroidered Chanderi Fabric</image:title>
      <image:caption>white-chanderi-silk-with-embroidered-black-lakhnawi-jaal</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-chanderi-silk-with-embroidered-red-lakhnawi-jaal</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-9-14-35-22_product_1_1649495122109.jpg?v=1649495146</image:loc>
      <image:title>White Red Lakhnawi Flowers Embroidered Chanderi Fabric</image:title>
      <image:caption>white-chanderi-silk-with-embroidered-red-lakhnawi-jaal</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/irregularshapedshellbeads158</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6091ddbcd5eb27b50e4d78d152fb9988.jpg?v=1649768656</image:loc>
      <image:title>Dark Gray Uneven Designer Shell Beads</image:title>
      <image:caption>irregularshapedshellbeads158</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/irregularshapedshellbeads159</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d0d3a9bcbfd85bd3d93aab0e08103a0e.jpg?v=1649768686</image:loc>
      <image:title>Light Pink Uneven Designer Shell Beads</image:title>
      <image:caption>irregularshapedshellbeads159</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/irregularshapedshellbeads160</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6ef5e5e8a637b703a9bd3555ed323b0c.jpg?v=1649768719</image:loc>
      <image:title>Green Uneven Designer Shell Beads</image:title>
      <image:caption>irregularshapedshellbeads160</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/irregularshapedshellbeads161</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2063702c75209dcb940aabce13495a1c.jpg?v=1649768749</image:loc>
      <image:title>Pink Uneven Designer Shell Beads</image:title>
      <image:caption>irregularshapedshellbeads161</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/facetedflatcrystalbeads163</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c73010572fccea784433daa9ceec9dde.jpg?v=1649768845</image:loc>
      <image:title>Light Golden Lustre Faceted Flat Crystal Beads</image:title>
      <image:caption>facetedflatcrystalbeads163</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/facetedflatcrystalbeads164</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d4a2d2aca644753de0213cfc60780a50.jpg?v=1649768877</image:loc>
      <image:title>Off White Faceted Flat Crystal Beads</image:title>
      <image:caption>facetedflatcrystalbeads164</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/facetedflatcrystalbeads165</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/82858db015257b8041b3906fe9fcd0a9.jpg?v=1649768909</image:loc>
      <image:title>Light Golden Faceted Flat Crystal Beads</image:title>
      <image:caption>facetedflatcrystalbeads165</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/facetedflatcrystalbeads166</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/026480f69685a7ab9e6fc8e462b2795c.jpg?v=1649768935</image:loc>
      <image:title>Dark Gray Faceted Flat Crystal Beads</image:title>
      <image:caption>facetedflatcrystalbeads166</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/facetedflatcrystalbeads167</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/57880b57bed5234abe0c450a2ff85d2b.jpg?v=1649768962</image:loc>
      <image:title>Black Faceted Flat Crystal Beads</image:title>
      <image:caption>facetedflatcrystalbeads167</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/germansilvermetalliclobsterclasps111</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/36acac9bbfe6214db2cf144fe4c3714e_6b116208-6002-4917-8cf8-e9e236db739a.jpg?v=1649765535</image:loc>
      <image:title>German Silver Metallic Lobster Clasps</image:title>
      <image:caption>germansilvermetalliclobsterclasps111</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/alphabetmetalliccharmsormetalliccharms114</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/75ed053eb72410b04e87a420d41718ca_379c6395-b351-43eb-ba38-976b5354eb59.jpg?v=1649765731</image:loc>
      <image:title>Sky Blue Designer Metallic Jewelry Charms</image:title>
      <image:caption>alphabetmetalliccharmsormetalliccharms114</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/alphabetmetalliccharmsormetalliccharms116</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/408ec4d37dc77df9850b5067ea696d12_65c065c5-fc2b-4ac4-8c02-3139105725b8.jpg?v=1649765825</image:loc>
      <image:title>Yellow Watermelon Metallic Jewelry Charms</image:title>
      <image:caption>alphabetmetalliccharmsormetalliccharms116</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/alphabetmetalliccharmsormetalliccharms117</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/385aeaa1ebaea4f8786f458614b2cea4_dd419041-549a-44ca-a5e6-fd0a2e33d2c8.jpg?v=1649765856</image:loc>
      <image:title>Multicolour Watermelon Metallic Jewelry Charms</image:title>
      <image:caption>alphabetmetalliccharmsormetalliccharms117</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/alphabetmetalliccharmsormetalliccharms120</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/29a1a68d1b911d72ed073ea048c79b66_0e34aaf7-2ec1-489a-9550-155fd6134e33.jpg?v=1649765946</image:loc>
      <image:title>Dark Blue Fancy Metallic Jewelry Charms</image:title>
      <image:caption>alphabetmetalliccharmsormetalliccharms120</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/doublesidedbarrelplasticbeads121</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/e7b7840522d2a113d8dc6cd064f93588_1aeb7362-4662-4a1f-bd0c-0fa968090f0b.jpg?v=1649765978</image:loc>
      <image:title>Neon Green Double Sided Barrel Plastic Beads</image:title>
      <image:caption>doublesidedbarrelplasticbeads121</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/doublesidedbarrelplasticbeads122</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/8de040991f58a94cfcf822a9f615b6ff_8d753182-1f4d-4d12-af23-27c80001c7cd.jpg?v=1649766015</image:loc>
      <image:title>Light Blue Double Sided Barrel Plastic Beads</image:title>
      <image:caption>doublesidedbarrelplasticbeads122</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/doublesidedbarrelplasticbeads123</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/8520b22fcd9f0967afbf944dca47b469_6fb39894-41a7-43d4-bd0c-1ec7ba01c396.jpg?v=1649766053</image:loc>
      <image:title>Red Double Sided Barrel Plastic Beads</image:title>
      <image:caption>doublesidedbarrelplasticbeads123</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/doublesidedbarrelplasticbeads124</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/592c186e4b0110ff2d96c568cbcd226c_d5a20765-db14-478a-814c-395dfb1fa29f.jpg?v=1649766124</image:loc>
      <image:title>Black Double Sided Barrel Plastic Beads</image:title>
      <image:caption>doublesidedbarrelplasticbeads124</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/doublesidedbarrelplasticbeads125</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/fdfd4695c61517ed81aa668da396e5dd_165c32c5-25d2-44e9-93f4-4b0122cd18c1.jpg?v=1649766161</image:loc>
      <image:title>Orange Double Sided Barrel Plastic Beads</image:title>
      <image:caption>doublesidedbarrelplasticbeads125</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/doublesidedbarrelplasticbeads126</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/29cf14fe1422f07dcad029658e3c057b.jpg?v=1649766202</image:loc>
      <image:title>Green Double Sided Barrel Plastic Beads</image:title>
      <image:caption>doublesidedbarrelplasticbeads126</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-green-cotton-plaid-check-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-11-7-16-56_product_3_1649641616949.jpg?v=1747550121</image:loc>
      <image:title>Light Green Plaid Checks Yarn Dyed Cotton Fabric</image:title>
      <image:caption>light-green-cotton-plaid-check-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multi-rose-cotton-plaid-check-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-11-7-40-37_product_3_1649643037158.jpg?v=1747549818</image:loc>
      <image:title>Multicolour Rose Pink Plaid Checks Yarn Dyed Cotton Fabric</image:title>
      <image:caption>multi-rose-cotton-plaid-check-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundfancy7stoneplasticbutton111</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2c3507fe5413c380f1a086d71b6fa8e3.jpg?v=1649759853</image:loc>
      <image:title>Maroon Round Fancy 7 Stone Plastic Button</image:title>
      <image:caption>roundfancy7stoneplasticbutton111</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundfancy7stoneplasticbutton112</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a3cde2277059709008dfb64c43930eeb.jpg?v=1649759889</image:loc>
      <image:title>Yellow Round Fancy 7 Stone Plastic Button</image:title>
      <image:caption>roundfancy7stoneplasticbutton112</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundfancy7stoneplasticbutton113</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/adcb9ee5d4e2df5794a9cc628ab67b15.jpg?v=1649759922</image:loc>
      <image:title>Deep Pink Round Fancy 7 Stone Plastic Button</image:title>
      <image:caption>roundfancy7stoneplasticbutton113</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundfancy7stoneplasticbutton114</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9e3a69eb4728344fd4fa00f62d70e778.jpg?v=1649759956</image:loc>
      <image:title>Green Round Fancy 7 Stone Plastic Button</image:title>
      <image:caption>roundfancy7stoneplasticbutton114</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundfancy7stoneplasticbutton115</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2e90a0d23d6c161556dd5521755d0fcb.jpg?v=1649759991</image:loc>
      <image:title>Black Round Fancy 7 Stone Plastic Button</image:title>
      <image:caption>roundfancy7stoneplasticbutton115</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundfancy7stoneplasticbutton116</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/964e85822a0f44c8f835361e09d875d3.jpg?v=1649760024</image:loc>
      <image:title>Purple Round Fancy 7 Stone Plastic Button</image:title>
      <image:caption>roundfancy7stoneplasticbutton116</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundfancy7stoneplasticbutton117</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/e4a123d88828a038a476ec60939b1de2.jpg?v=1649760063</image:loc>
      <image:title>Orange Round Fancy 7 Stone Plastic Button</image:title>
      <image:caption>roundfancy7stoneplasticbutton117</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundfancy7stoneplasticbutton118</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6ae6cd54a1b1f91e42928458b447270b.jpg?v=1649760127</image:loc>
      <image:title>Coral Pink Round Fancy 7 Stone Plastic Button</image:title>
      <image:caption>roundfancy7stoneplasticbutton118</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundfancy7stoneplasticbutton119</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/8cb5fb10853ff94d23e1929709d78c0b.jpg?v=1649760159</image:loc>
      <image:title>Dull Black Round Fancy 7 Stone Plastic Button</image:title>
      <image:caption>roundfancy7stoneplasticbutton119</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundfancy7stoneplasticbutton120</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/15adea7201ca332091d4c1ef165eed36.jpg?v=1649760192</image:loc>
      <image:title>Light Blue Round Fancy 7 Stone Plastic Button</image:title>
      <image:caption>roundfancy7stoneplasticbutton120</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundfancy7stoneplasticbutton121</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/80fcf89ad5cd4fa91541997b6b9b7c4c.jpg?v=1649760226</image:loc>
      <image:title>Light Brown Round Fancy 7 Stone Plastic Button</image:title>
      <image:caption>roundfancy7stoneplasticbutton121</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundfancy7stoneplasticbutton122</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a1c154ca4221efa92b5e00621c6b71cd.jpg?v=1649760261</image:loc>
      <image:title>White Round Fancy 7 Stone Plastic Button</image:title>
      <image:caption>roundfancy7stoneplasticbutton122</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundfancy7stoneplasticbutton123</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9daa44153c0f2631ce08af7508dba0dc.jpg?v=1649760293</image:loc>
      <image:title>Magenta Pink Round Fancy 7 Stone Plastic Button</image:title>
      <image:caption>roundfancy7stoneplasticbutton123</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundfancy7stoneplasticbutton124</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/4db9fffc2f62ed2ca2181649f2328e25.jpg?v=1649760329</image:loc>
      <image:title>Bright Pink Round Fancy 7 Stone Plastic Button</image:title>
      <image:caption>roundfancy7stoneplasticbutton124</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundfancy7stoneplasticbutton125</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/8eeaffd82c73b0bc75234ad6f0abfc6b.jpg?v=1649760392</image:loc>
      <image:title>Dark Orange Round Fancy 7 Stone Plastic Button</image:title>
      <image:caption>roundfancy7stoneplasticbutton125</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundfancy7stoneplasticbutton126</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/be699bcbb504709fe42ba2ec4ad1fd33.jpg?v=1649760426</image:loc>
      <image:title>Light Green Round Fancy 7 Stone Plastic Button</image:title>
      <image:caption>roundfancy7stoneplasticbutton126</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundfancy7stoneplasticbutton127</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/fc1ae4f6fefe817db2c7db49817badf2.jpg?v=1649760460</image:loc>
      <image:title>Blue Round Fancy 7 Stone Plastic Button</image:title>
      <image:caption>roundfancy7stoneplasticbutton127</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundfancy7stoneplasticbutton128</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/fb21fbe14253a81fdc77faee3f866a5e.jpg?v=1649760494</image:loc>
      <image:title>Red Round Fancy 7 Stone Plastic Button</image:title>
      <image:caption>roundfancy7stoneplasticbutton128</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundfancy7stoneplasticbutton129</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2dd9aa46984d7f4bf2b1483f773e2967.jpg?v=1649760528</image:loc>
      <image:title>Bright Yellow Round Fancy 7 Stone Plastic Button</image:title>
      <image:caption>roundfancy7stoneplasticbutton129</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundfancy7stoneplasticbutton130</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/5f29118c8a52f3bf2169ba71f4c9c452.jpg?v=1649760560</image:loc>
      <image:title>Light Brown Round Fancy 7 Stone Plastic Button</image:title>
      <image:caption>roundfancy7stoneplasticbutton130</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundfancy7stoneplasticbutton131</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/8b492e16bfd9b2dfdbbb39d7548367b7.jpg?v=1649760624</image:loc>
      <image:title>Teal Green Round Fancy 7 Stone Plastic Button</image:title>
      <image:caption>roundfancy7stoneplasticbutton131</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundfancy7stoneplasticbutton132</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cb5507466f61d9803241e3db9724ffc0.jpg?v=1649760657</image:loc>
      <image:title>Bright Blue Round Fancy 7 Stone Plastic Button</image:title>
      <image:caption>roundfancy7stoneplasticbutton132</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundfancy7stoneplasticbutton133</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c2e2fda8a4a83ca4cf1dee271fddc947.jpg?v=1649760690</image:loc>
      <image:title>Dark Brown Round Fancy 7 Stone Plastic Button</image:title>
      <image:caption>roundfancy7stoneplasticbutton133</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/roundfancy7stoneplasticbutton134</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d54d48f40c44345684e2d7265b98d732.jpg?v=1649760724</image:loc>
      <image:title>Light Orange Round Fancy 7 Stone Plastic Button</image:title>
      <image:caption>roundfancy7stoneplasticbutton134</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/indianhandmadefancyevaieyelampworkglassbeads216</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/8bd13b7d4c44a81587a75fd468568319.jpg?v=1649761272</image:loc>
      <image:title>Blood Red Teardrop Painted Glass Beads- 13x10 mm</image:title>
      <image:caption>indianhandmadefancyevaieyelampworkglassbeads216</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-circular-acrylic-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/3_85_5ebd0d5a-a778-4453-bc63-8f58426c41c9.jpg?v=1649768110</image:loc>
      <image:title>Yellow Circular Acrylic Buttons</image:title>
      <image:caption>yellow-circular-acrylic-buttons-stc280220-335</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/beautiful-traditional-design-buttons-in-black-color</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-13-0-13-43_product_1_1649843023898.jpg?v=1649789026</image:loc>
      <image:title>Black Gold Designer Metal Coat Buttons</image:title>
      <image:caption>beautiful-traditional-design-buttons-in-black-color</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/beautiful-traditional-design-buttons-in-blue-color</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-14-19-22-24_product_1_1649998344966.jpg?v=1650008926</image:loc>
      <image:title>Blue Gold Designer Metal Coat Buttons</image:title>
      <image:caption>beautiful-traditional-design-buttons-in-blue-color</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pre-cut-black-white-polka-pink-floral-digital-printed-georgette-fabric-3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Black_White_Polka_Pink_Floral_Digital_Printed_Georgette_Fabric_product_1_1612940431041_0f668f99-cc1e-41e7-a41f-775ed678879b.jpg?v=1649845847</image:loc>
      <image:title>Precut Black White Polka Pink Floral Digital Printed Georgette Fabric</image:title>
      <image:caption>black-white-polka-pink-floral-digital-printed-georgette-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-brown-new-cut-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-13-16-19-25_product_1_1649846965974.jpg?v=1649846975</image:loc>
      <image:title>Dark Brown New Cut Glass Crystal Beads</image:title>
      <image:caption>dark-brown-new-cut-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/montana-blue-oval-glass-beads-with-golden-catcher-30x20mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-14-20-29-37_product_1_1649948377573.jpg?v=1748249058</image:loc>
      <image:title>Montana Blue Oval Glass Stone With Golden Catcher- 30x20mm</image:title>
      <image:caption>montana-blue-oval-glass-beads-with-golden-catcher-30x20mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-2-hole-oval-glass-beads-18x13mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-14-20-51-59_product_1_1649949719181.jpg?v=1746383923</image:loc>
      <image:title>Silver 2 Hole Oval Glass Beads- 18x13mm</image:title>
      <image:caption>silver-2-hole-oval-glass-beads-18x13mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pearl-white-leaf-one-hole-plastic-beads-32x15mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-17-19-53-36_product_1_1650205416239.jpg?v=1650205425</image:loc>
      <image:title>Pearl White Leaf One Hole Plastic Beads- 32x15mm</image:title>
      <image:caption>pearl-white-leaf-one-hole-plastic-beads-32x15mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pearl-off-white-fancy-plastic-beads-21x15mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-17-19-57-54_product_1_1650205674583.jpg?v=1650205683</image:loc>
      <image:title>Pearl Off White Fancy Plastic Beads- 21x15mm</image:title>
      <image:caption>pearl-off-white-fancy-plastic-beads-21x15mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pearl-off-white-triangular-plastic-beads-5x12mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-17-20-0-48_product_1_1650205848136.jpg?v=1650205857</image:loc>
      <image:title>Pearl Off White Triangular Plastic Beads- 5x12mm</image:title>
      <image:caption>pearl-off-white-triangular-plastic-beads-5x12mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pearl-white-flowers-plastic-beads-16mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-17-20-3-15_product_1_1650205995964.jpg?v=1650206005</image:loc>
      <image:title>Pearl White Flowers Plastic Beads- 16mm</image:title>
      <image:caption>pearl-white-flowers-plastic-beads-16mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pearl-white-rounded-square-plastic-beads-12x12mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-17-20-5-31_product_1_1650206131233.jpg?v=1650206140</image:loc>
      <image:title>Pearl White Rounded Square Plastic Beads- 12x12mm</image:title>
      <image:caption>pearl-white-rounded-square-plastic-beads-12x12mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pearl-white-floral-plastic-beads-14mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-17-20-8-43_product_1_1650206323072.jpg?v=1650206332</image:loc>
      <image:title>Pearl White Floral Plastic Beads- 14mm</image:title>
      <image:caption>pearl-white-floral-plastic-beads-14mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/uncutshellbeads2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2f990ddf0ef75e2f7b200483ed631acb.jpg?v=1650278751</image:loc>
      <image:title>Dark Green Uncut Shell Beads</image:title>
      <image:caption>uncutshellbeads2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/uncutshellbeads3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a72dbb5681c0696b6bd3d7f91a27ed5f.jpg?v=1650278783</image:loc>
      <image:title>Mustard Yellow Uncut Shell Beads</image:title>
      <image:caption>uncutshellbeads3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/uncutshellbeads4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/308769c5f2d31e0e87e2b8de013e67c2.jpg?v=1650278813</image:loc>
      <image:title>Brown Uncut Shell Beads</image:title>
      <image:caption>uncutshellbeads4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/uncutshellbeads5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/dcc7cbf22c77421b401bfdec042db328.jpg?v=1650278843</image:loc>
      <image:title>Mustard Brown Uncut Shell Beads</image:title>
      <image:caption>uncutshellbeads5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/uncutshellbeads6</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d693f6ab49b54e2a3802f4d2e17ba29b.jpg?v=1650278875</image:loc>
      <image:title>Red Uncut Shell Beads</image:title>
      <image:caption>uncutshellbeads6</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/uncutshellbeads7</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/3ffa37f93049f4ebb74e895a757f6c4e.jpg?v=1650278906</image:loc>
      <image:title>Light Brown Uncut Shell Beads</image:title>
      <image:caption>uncutshellbeads7</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/plasticstonecords4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/f3ddec38cf4d7a9a791f89e6601d1ce4.jpg?v=1650279014</image:loc>
      <image:title>Black Lustre Plastic Stone Cords</image:title>
      <image:caption>plasticstonecords4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/plasticstonecords8</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9b54eaef4d99f26945999109bbbb6d71.jpg?v=1650279112</image:loc>
      <image:title>Black Plastic Stone Cords</image:title>
      <image:caption>plasticstonecords8</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/plasticstonecords9</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/8f62832655159bb094579fa90d57a72a.jpg?v=1650279129</image:loc>
      <image:title>Red Plastic Stone Cords</image:title>
      <image:caption>plasticstonecords9</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/uncutshellbeads8</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/570b47685644ec18166af2fa1f6b7ee4.jpg?v=1650279345</image:loc>
      <image:title>Pink Designer Uncut Shell Beads</image:title>
      <image:caption>uncutshellbeads8</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/uncutshellbeads9</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/4fdb14284a0fd43b9c0beeaabff03517.jpg?v=1650279375</image:loc>
      <image:title>Green Designer Uncut Shell Beads</image:title>
      <image:caption>uncutshellbeads9</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/uncutshellbeads11</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c0bd0de19e498f21574e77c7f163421f.jpg?v=1650279466</image:loc>
      <image:title>Blue Cream Designer Uncut Shell Beads</image:title>
      <image:caption>uncutshellbeads11</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/uncutshellbeads12</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/25020bdafe123fd608fe63ada4494b22.jpg?v=1650279497</image:loc>
      <image:title>Brown Designer Uncut Shell Beads</image:title>
      <image:caption>uncutshellbeads12</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/plasticbeads1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/510d97c2263ea5acae0e1a7422c90479.jpg?v=1650279560</image:loc>
      <image:title>Multicolour Eye Plastic Beads</image:title>
      <image:caption>plasticbeads1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/plasticbeads2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c82299c4552ed249ccdd29afed244f1c.jpg?v=1650279591</image:loc>
      <image:title>Multicolour Asymmetric Plastic Beads</image:title>
      <image:caption>plasticbeads2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/drumshapedplasticbeads1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/8e7f3ca6020b7ed5d19018be6f2f5ba0.jpg?v=1650279688</image:loc>
      <image:title>Black Silver Drum Plastic Beads</image:title>
      <image:caption>drumshapedplasticbeads1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/drumshapedplasticbeads2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/5c3b7e1b6c30326cc5625e1206115ca5.jpg?v=1650279743</image:loc>
      <image:title>Green Silver Drum Plastic Beads</image:title>
      <image:caption>drumshapedplasticbeads2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/uncutglassbeads1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/3d4307869feb85e376ff9edea27c51c2.jpg?v=1650279828</image:loc>
      <image:title>Blue Uncut Glass Beads</image:title>
      <image:caption>uncutglassbeads1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/uncutglassbeads2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d6c79e9238c3bd557880ce7fa0e232b3.jpg?v=1650279858</image:loc>
      <image:title>Brown Uncut Glass Beads</image:title>
      <image:caption>uncutglassbeads2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/uncutglassbeads3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/5d9d6f02195000dae8b5871c5beb83b3.jpg?v=1650279888</image:loc>
      <image:title>Green Uncut Glass Beads</image:title>
      <image:caption>uncutglassbeads3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/uncutglassbeads4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6951d5777c9e5b680aafe2dff4dc758e.jpg?v=1650279921</image:loc>
      <image:title>White Uncut Glass Beads</image:title>
      <image:caption>uncutglassbeads4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/uncutglassbeads5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1291c79e4a7a83e2876da044a666e246.jpg?v=1650279953</image:loc>
      <image:title>White Transparent Uncut Glass Beads</image:title>
      <image:caption>uncutglassbeads5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/drumshapedplasticbeads3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a4ac2bca41513ebaa5c2027590179d02.jpg?v=1650280017</image:loc>
      <image:title>Silver Drum Plastic Beads- 12 mm</image:title>
      <image:caption>drumshapedplasticbeads3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/drumshapedplasticbeads4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a4ac2bca41513ebaa5c2027590179d02_445ee242-b203-497f-ba02-cf87a6cf7f87.jpg?v=1650280078</image:loc>
      <image:title>Silver Drum Plastic Beads- 10 mm</image:title>
      <image:caption>drumshapedplasticbeads4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/drumshapedplasticbeads5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a4ac2bca41513ebaa5c2027590179d02_cf00910f-39c0-46ae-bbda-7eded0b017da.jpg?v=1650280109</image:loc>
      <image:title>Silver Drum Plastic Beads- 16 mm</image:title>
      <image:caption>drumshapedplasticbeads5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/acrylicmaskchain3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/ba57b25526f76dd0d1fd370f7904b0dd.jpg?v=1650280174</image:loc>
      <image:title>Red Circular Acrylic Mask Chain</image:title>
      <image:caption>acrylicmaskchain3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/acrylicmaskchain4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6a2d713ba4dd23d33126a85f44b6110c.jpg?v=1650280207</image:loc>
      <image:title>Light Blue Circular Acrylic Mask Chain</image:title>
      <image:caption>acrylicmaskchain4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/plasticbeads4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/886f6654fbedd28ecd410acaa62458c1.jpg?v=1650280269</image:loc>
      <image:title>Off White Oval Plastic Beads</image:title>
      <image:caption>plasticbeads4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/plasticbeads5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/370cbf0698015476ff3cecead66bc9b4.jpg?v=1650280330</image:loc>
      <image:title>Off White Drop Plastic Beads</image:title>
      <image:caption>plasticbeads5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/plasticbeads6</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/fbe57aa88c68be36c5d7f713d7eb1fad.jpg?v=1650280361</image:loc>
      <image:title>Off White Eye Plastic Beads</image:title>
      <image:caption>plasticbeads6</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/plasticbeads8</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/fa6af4bf6cb21383e04351170df0d643.jpg?v=1650280424</image:loc>
      <image:title>Off White Heart Plastic Beads</image:title>
      <image:caption>plasticbeads8</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transperenthydrosphericalcrystalbeads1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1b2e7776dffd854fe5d2d76209d29a97.jpg?v=1750929074</image:loc>
      <image:title>Light Green Transparent Hydro Spherical Crystal Beads</image:title>
      <image:caption>transperenthydrosphericalcrystalbeads1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transperenthydrosphericalcrystalbeads2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/39ee2b6b959e5732045296f07df52972.jpg?v=1750929072</image:loc>
      <image:title>Blue Transparent Hydro Spherical Crystal Beads</image:title>
      <image:caption>transperenthydrosphericalcrystalbeads2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transperenthydrosphericalcrystalbeads3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/b76d2dca4f7d8822dbe0626d92eafb80.jpg?v=1750929070</image:loc>
      <image:title>Orange Transparent Hydro Spherical Crystal Beads</image:title>
      <image:caption>transperenthydrosphericalcrystalbeads3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transperenthydrosphericalcrystalbeads4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c70e57e4a010a479d6dd1c68cea330fd.jpg?v=1750929068</image:loc>
      <image:title>Light Purple Transparent Hydro Spherical Crystal Beads</image:title>
      <image:caption>transperenthydrosphericalcrystalbeads4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transperenthydrosphericalcrystalbeads5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/4e6b47e9ede88b658dc6afc825b6525f.jpg?v=1750929066</image:loc>
      <image:title>Orange Transparent Hydro Spherical Crystal Beads</image:title>
      <image:caption>transperenthydrosphericalcrystalbeads5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transperenthydrosphericalcrystalbeads6</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/45131ab035a2d473992155f7169edee7.jpg?v=1750929065</image:loc>
      <image:title>Golden Transparent Hydro Spherical Crystal Beads</image:title>
      <image:caption>transperenthydrosphericalcrystalbeads6</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transperenthydrosphericalcrystalbeads7</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d58476e7d5c9f67afa38575bcfba6890.jpg?v=1750929063</image:loc>
      <image:title>Brown Transparent Hydro Spherical Crystal Beads</image:title>
      <image:caption>transperenthydrosphericalcrystalbeads7</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transperenthydrosphericalcrystalbeads8</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/3fc0f1c7144ceaf44412d054c976966d.jpg?v=1750929061</image:loc>
      <image:title>Dark Orange Transparent Hydro Spherical Crystal Beads</image:title>
      <image:caption>transperenthydrosphericalcrystalbeads8</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transperenthydrosphericalcrystalbeads9</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/f701fe357b794e1d33b01d802b656f09.jpg?v=1750929059</image:loc>
      <image:title>Purple Transparent Hydro Spherical Crystal Beads</image:title>
      <image:caption>transperenthydrosphericalcrystalbeads9</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transperenthydrosphericalcrystalbeads10</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/5385b5eb93af102075a5931db05978fd.jpg?v=1750929057</image:loc>
      <image:title>Dark Purple Transparent Hydro Spherical Crystal Beads</image:title>
      <image:caption>transperenthydrosphericalcrystalbeads10</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transperenthydrosphericalcrystalbeads11</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/8c6c049e3cf79be134900436685b187a.jpg?v=1750929055</image:loc>
      <image:title>Light Orange Transparent Hydro Spherical Crystal Beads</image:title>
      <image:caption>transperenthydrosphericalcrystalbeads11</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transperenthydrosphericalcrystalbeads12</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/e71f7c240bb8d0b72143fe6aa967556c.jpg?v=1750929053</image:loc>
      <image:title>Light Blue Transparent Hydro Spherical Crystal Beads</image:title>
      <image:caption>transperenthydrosphericalcrystalbeads12</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transperenthydrosphericalcrystalbeads13</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/da29df0e81eec7f8504e4d982141f464.jpg?v=1750929051</image:loc>
      <image:title>Green Transparent Hydro Spherical Crystal Beads</image:title>
      <image:caption>transperenthydrosphericalcrystalbeads13</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transperenthydrosphericalcrystalbeads14</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/f5759870bc50072ea0d514145eca3cca.jpg?v=1750929050</image:loc>
      <image:title>Mustard Transparent Hydro Spherical Crystal Beads</image:title>
      <image:caption>transperenthydrosphericalcrystalbeads14</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/nylonrafiaribbon2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6c43544dc0b39464b612e1f3b2015e4f.jpg?v=1650281005</image:loc>
      <image:title>Dark Green Nylon Raffia Ribbon</image:title>
      <image:caption>nylonrafiaribbon2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/nylonrafiaribbon3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9f50c5208115f9bf1e6111a5c6c00cae.jpg?v=1650281068</image:loc>
      <image:title>Green Nylon Raffia Ribbon</image:title>
      <image:caption>nylonrafiaribbon3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/nylonrafiaribbon4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/036b42e00ded4c978ae93f7b6365c720.jpg?v=1650281098</image:loc>
      <image:title>Sky Blue Nylon Raffia Ribbon</image:title>
      <image:caption>nylonrafiaribbon4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/nylonrafiaribbon5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6bc47ec20eaeb3f5e7162e50c29110d7.jpg?v=1650281130</image:loc>
      <image:title>Light Blue Nylon Raffia Ribbon</image:title>
      <image:caption>nylonrafiaribbon5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/nylonrafiaribbon6</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d1f57e10e34be7e221137cfcc305c642.jpg?v=1650281163</image:loc>
      <image:title>Red Nylon Raffia Ribbon</image:title>
      <image:caption>nylonrafiaribbon6</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/nylonrafiaribbon7</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cfe1bfe131ed2c39519b720eac1445dd.jpg?v=1650281194</image:loc>
      <image:title>Dark Red Nylon Raffia Ribbon</image:title>
      <image:caption>nylonrafiaribbon7</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/nylonrafiaribbon8</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/434bd7bedecfa1c22512d7de43765e05.jpg?v=1650281225</image:loc>
      <image:title>Black Nylon Raffia Ribbon</image:title>
      <image:caption>nylonrafiaribbon8</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/nylonrafiaribbon10</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/fcd0a6c8f3755d041f3adf1e564e9e12.jpg?v=1650281317</image:loc>
      <image:title>Dark Blue Nylon Raffia Ribbon</image:title>
      <image:caption>nylonrafiaribbon10</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/nylonrafiaribbon11</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/51f62981c824038d9a959bca1a6a3921.jpg?v=1650281347</image:loc>
      <image:title>Pink Nylon Raffia Ribbon</image:title>
      <image:caption>nylonrafiaribbon11</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/nylonrafiaribbon12</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a6eac51647683b7a4272527cd98cda7a.jpg?v=1650281379</image:loc>
      <image:title>Light Pink Nylon Raffia Ribbon</image:title>
      <image:caption>nylonrafiaribbon12</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/zebraprinteddesignerglassbeads1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2974c3b9a7972e578a030acac9d4624a.jpg?v=1650281411</image:loc>
      <image:title>White Blue Zebra Printed Designer Glass Beads</image:title>
      <image:caption>zebraprinteddesignerglassbeads1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/uncutglassbeads8</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/63b3350e3ab317f336e7a610ffab544a.jpg?v=1650281568</image:loc>
      <image:title>Baby Pink Pink Uncut Glass Beads</image:title>
      <image:caption>uncutglassbeads8</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/uncutglassbeads10</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/91491da171e5e6659e5fb9017ca36d74.jpg?v=1650281629</image:loc>
      <image:title>Black Uncut Glass Beads</image:title>
      <image:caption>uncutglassbeads10</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/copperplasticlockcharms1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/ed95b8fb54e6419ee6b345a8bf56ba4c.jpg?v=1650281695</image:loc>
      <image:title>Copper Plastic Lock Charms</image:title>
      <image:caption>copperplasticlockcharms1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/flowershapedplasticembellishments1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/5b8c680557640f5d3ebe1e14d97ca9b3.jpg?v=1650281788</image:loc>
      <image:title>Red Flower Plastic Embellishments</image:title>
      <image:caption>flowershapedplasticembellishments1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/flowershapedplasticembellishments4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/5d4d2289ac5ca987cf9d9b2e2a16b83d.jpg?v=1650281894</image:loc>
      <image:title>Blue Flower Plastic Embellishments</image:title>
      <image:caption>flowershapedplasticembellishments4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/flowershapedplasticembellishments5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/ce399f161cd7cb8a43546cc3a9816704.jpg?v=1650281926</image:loc>
      <image:title>Brown Flower Plastic Embellishments</image:title>
      <image:caption>flowershapedplasticembellishments5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/flowershapedplasticembellishments7</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/e5d2b6ab72cc76d833dbc9a8652d211b.jpg?v=1650282023</image:loc>
      <image:title>Dark Green Flower Plastic Embellishments</image:title>
      <image:caption>flowershapedplasticembellishments7</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-colour-handloom-jharna-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-18-21-12-9_product_1_1650296529606.jpg?v=1650296544</image:loc>
      <image:title>Black Plain Self Handloom Jharna Cotton Fabric</image:title>
      <image:caption>black-colour-handloom-jharna-cotton-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/antique-golden-lion-metal-buttons-for-suit</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-0-2-34_product_1_1650360754558.jpg?v=1757865446</image:loc>
      <image:title>Antique Golden Lion Metal  Buttons for Suit</image:title>
      <image:caption>antique-golden-lion-metal-buttons-for-suit</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-gold-designer-metal-suit-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-0-33-49_product_1_1650362629263.jpg?v=1650308624</image:loc>
      <image:title>Black Gold Designer Metal Suit Buttons</image:title>
      <image:caption>black-gold-designer-metal-suit-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/circularhandmadelampworkglassbeads1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/7b818f3393396bec1c9118ba25e42796.jpg?v=1650364901</image:loc>
      <image:title>Light Blue Circular Handmade Lampwork Glass Beads</image:title>
      <image:caption>circularhandmadelampworkglassbeads1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/circularhandmadelampworkglassbeads4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/7b5a11582ff37d9948a6793379dddc28.jpg?v=1650365016</image:loc>
      <image:title>Red Circular Handmade Lampwork Glass Beads</image:title>
      <image:caption>circularhandmadelampworkglassbeads4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/circularhandmadelampworkglassbeads5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a4862ad1760be94ef6e5cd839fe6be88.jpg?v=1650365052</image:loc>
      <image:title>Light Pink Circular Handmade Lampwork Glass Beads</image:title>
      <image:caption>circularhandmadelampworkglassbeads5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/floralshapedplasticembellishments1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9bca4883931622fbde64da6cba84229e.jpg?v=1650365385</image:loc>
      <image:title>Blue Floral Plastic Embellishments</image:title>
      <image:caption>floralshapedplasticembellishments1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/floralshapedplasticembellishments2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/e5dca9e1dabda4b2a21e9cf10592049e.jpg?v=1650365442</image:loc>
      <image:title>Magenta Pink Floral Plastic Embellishments</image:title>
      <image:caption>floralshapedplasticembellishments2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/plasticcharms1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/13e0d930eae170773cdf933dbb59660b.jpg?v=1650365504</image:loc>
      <image:title>Silver Plastic Lock Charms</image:title>
      <image:caption>plasticcharms1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/plasticcharms2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/919f3dc9e3b0a3ccd80b3caaac9ccd53.jpg?v=1650366678</image:loc>
      <image:title>Golden Plastic Lock Charms</image:title>
      <image:caption>plasticcharms2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/nylonthreadcords4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/3e8aa4d09dbae58f172e244f0f36cc2e.jpg?v=1650365753</image:loc>
      <image:title>Yellow Nylon Thread Cords</image:title>
      <image:caption>nylonthreadcords4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/hamidite-grey-circular-chandala-glass-beads-3mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-16-47-50_product_1_1650367070819.jpg?v=1650367080</image:loc>
      <image:title>Hamidite Gray Circular Chandala Glass Embellishment- 3mm</image:title>
      <image:caption>hamidite-grey-circular-chandala-glass-beads-3mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-circular-chandala-glass-beads-3mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-16-57-8_product_1_1650367628381.jpg?v=1650367639</image:loc>
      <image:title>Black Circular Chandala Glass Embellishment- 3mm</image:title>
      <image:caption>black-circular-chandala-glass-beads-3mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/grey-circular-chandala-glass-beads-3mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-16-59-3_product_1_1650367743652.jpg?v=1650367753</image:loc>
      <image:title>Gray Circular Chandala Glass Embellishment- 3mm</image:title>
      <image:caption>grey-circular-chandala-glass-beads-3mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pose-pink-circular-chandala-glass-beads-3mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-17-0-46_product_1_1650367846596.jpg?v=1650367856</image:loc>
      <image:title>Rose Pink Circular Chandala Glass Embellishment- 3mm</image:title>
      <image:caption>pose-pink-circular-chandala-glass-beads-3mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/olive-green-circular-chandala-glass-beads-3mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-19-56-19_product_1_1650378379667.jpg?v=1746384075</image:loc>
      <image:title>Olive Green Circular Chandala Glass Embellishment- 3mm</image:title>
      <image:caption>olive-green-circular-chandala-glass-beads-3mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/sky-blue-circular-chandala-glass-beads-3mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-19-58-20_product_1_1650378500228.jpg?v=1746384120</image:loc>
      <image:title>Sky Blue Circular Chandala Glass Embellishment- 3mm</image:title>
      <image:caption>sky-blue-circular-chandala-glass-beads-3mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/topaz-golden-circular-chandala-glass-beads-3mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-20-2-3_product_1_1650378723886.jpg?v=1650378733</image:loc>
      <image:title>Topaz Golden Circular Chandala Glass Embellishment- 3mm</image:title>
      <image:caption>topaz-golden-circular-chandala-glass-beads-3mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-grey-circular-chandala-glass-beads-3mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-20-4-14_product_1_1650378854717.jpg?v=1650378864</image:loc>
      <image:title>Light Gray Circular Chandala Glass Embellishment- 3mm</image:title>
      <image:caption>light-grey-circular-chandala-glass-beads-3mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pastel-blue-circular-chandala-glass-beads-3mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-20-6-28_product_1_1650378988806.jpg?v=1746425323</image:loc>
      <image:title>Pastel Blue Circular Chandala Glass Embellishment- 3mm</image:title>
      <image:caption>pastel-blue-circular-chandala-glass-beads-3mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fuchsia-pink-circular-chandala-glass-beads-3mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-20-10-6_product_1_1650379206237.jpg?v=1746384138</image:loc>
      <image:title>Fuchsia Pink Circular Chandala Glass Embellishment- 3mm</image:title>
      <image:caption>fuchsia-pink-circular-chandala-glass-beads-3mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-circular-chandala-glass-beads-3mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-20-11-50_product_1_1650379310783.jpg?v=1746425354</image:loc>
      <image:title>Peach Circular Chandala Glass Embellishment- 3mm</image:title>
      <image:caption>peach-circular-chandala-glass-beads-3mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-red-circular-chandala-glass-beads-3mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-20-13-21_product_1_1650379401078.jpg?v=1746425650</image:loc>
      <image:title>Dark Red Circular Chandala Glass Embellishment- 3mm</image:title>
      <image:caption>dark-red-circular-chandala-glass-beads-3mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/lct-golden-circular-chandala-glass-beads-2mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-20-28-49_product_1_1650380329153.jpg?v=1746426444</image:loc>
      <image:title>LCT Golden Circular Chandala Glass Embellishment- 2 mm</image:title>
      <image:caption>lct-golden-circular-chandala-glass-beads-2mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/teal-green-circular-chandala-glass-beads-2mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-20-30-25_product_1_1650380425986.jpg?v=1746426012</image:loc>
      <image:title>Teal Green Circular Chandala Glass Embellishment- 2 mm</image:title>
      <image:caption>teal-green-circular-chandala-glass-beads-2mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-drop-glass-beads-8x5mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-20-38-20_product_1_1650380900903.jpg?v=1746426754</image:loc>
      <image:title>Silver Drop Glass Embellishment - 8x5mm</image:title>
      <image:caption>silver-drop-glass-beads-8x5mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-circular-chandala-glass-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-20-41-17_product_1_1650381077947.jpg?v=1746427288</image:loc>
      <image:title>Silver Circular Chandala Glass Embellishment- 4 mm</image:title>
      <image:caption>silver-circular-chandala-glass-beads-4mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-circular-chandala-glass-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-20-42-59_product_1_1650381179372.jpg?v=1650381190</image:loc>
      <image:title>Red Circular Chandala Glass Embellishment- 4 mm</image:title>
      <image:caption>red-circular-chandala-glass-beads-4mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/teal-green-circular-chandala-glass-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-20-49-24_product_1_1650381564549.jpg?v=1746427006</image:loc>
      <image:title>Teal Green Circular Chandala Glass Embellishment- 4 mm</image:title>
      <image:caption>teal-green-circular-chandala-glass-beads-4mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-circular-chandala-glass-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-20-50-49_product_1_1650381649395.jpg?v=1650381659</image:loc>
      <image:title>Blue Circular Chandala Glass Embellishment- 4 mm</image:title>
      <image:caption>blue-circular-chandala-glass-beads-4mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/olive-green-circular-chandala-glass-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-20-52-17_product_1_1650381737792.jpg?v=1650381756</image:loc>
      <image:title>Olive Green Circular Chandala Glass Embellishment- 4 mm</image:title>
      <image:caption>olive-green-circular-chandala-glass-beads-4mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-aqua-blue-circular-chandala-glass-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-20-54-6_product_1_1650381846311.jpg?v=1746427025</image:loc>
      <image:title>Light Aqua Blue Circular Chandala Glass Embellishment- 4 mm</image:title>
      <image:caption>light-aqua-blue-circular-chandala-glass-beads-4mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-mauve-circular-chandala-glass-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-20-56-0_product_1_1650381960889.jpg?v=1650381970</image:loc>
      <image:title>Light Mauve Circular Chandala Glass Embellishment- 4 mm</image:title>
      <image:caption>light-mauve-circular-chandala-glass-beads-4mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-circular-chandala-glass-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-20-57-40_product_1_1650382060873.jpg?v=1650382070</image:loc>
      <image:title>Multicolour Circular Chandala Glass Embellishment- 4 mm</image:title>
      <image:caption>multicolor-circular-chandala-glass-beads-4mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-circular-chandala-glass-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-20-59-12_product_1_1650382152723.jpg?v=1650382162</image:loc>
      <image:title>Black Circular Chandala Glass Embellishment- 4 mm</image:title>
      <image:caption>black-circular-chandala-glass-beads-4mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-blue-circular-chandala-glass-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-21-0-36_product_1_1650382236172.jpg?v=1650382249</image:loc>
      <image:title>Dark Blue Circular Chandala Glass Embellishment- 4 mm</image:title>
      <image:caption>dark-blue-circular-chandala-glass-beads-4mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-circular-chandala-glass-beads-4mm-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-21-2-12_product_1_1650382332203.jpg?v=1650382342</image:loc>
      <image:title>Red Circular Chandala Glass Embellishment- 4 mm</image:title>
      <image:caption>red-circular-chandala-glass-beads-4mm-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-amethyst-purple-circular-chandala-glass-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-19-21-5-16_product_1_1650382516597.jpg?v=1650382526</image:loc>
      <image:title>Light Amethyst Purple Circular Chandala Glass Embellishment- 4 mm</image:title>
      <image:caption>light-amethyst-purple-circular-chandala-glass-beads-4mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/grey-chanderi-with-white-chikankari-embroidery-work</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-20-11-45-59_product_1_1650435359299.jpg?v=1650435396</image:loc>
      <image:title>Gray White Chikankari Embroidered Chanderi Fabric</image:title>
      <image:caption>grey-chanderi-with-white-chikankari-embroidery-work</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-red-circular-chandala-glass-embellishment-5-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-20-18-3-21_product_1_1650458001744.jpg?v=1650458010</image:loc>
      <image:title>Dark Red Circular Chandala Glass Embellishment- 5 mm</image:title>
      <image:caption>dark-red-circular-chandala-glass-embellishment-5-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-aqua-blue-circular-chandala-glass-embellishment-5-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-20-18-6-52_product_1_1650458212564.jpg?v=1650458221</image:loc>
      <image:title>Dark Aqua Blue Circular Chandala Glass Embellishment- 5 mm</image:title>
      <image:caption>dark-aqua-blue-circular-chandala-glass-embellishment-5-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/olive-green-circular-chandala-glass-embellishment-5-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-20-18-44-42_product_1_1650460482213.jpg?v=1650460491</image:loc>
      <image:title>Olive Green Circular Chandala Glass Embellishment- 5 mm</image:title>
      <image:caption>olive-green-circular-chandala-glass-embellishment-5-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-red-rainbow-circular-chandala-glass-embellishment-5-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-20-18-47-39_product_1_1650460659666.jpg?v=1650460668</image:loc>
      <image:title>Dark Red Rainbow Circular Chandala Glass Embellishment- 5 mm</image:title>
      <image:caption>dark-red-rainbow-circular-chandala-glass-embellishment-5-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/aqua-blue-circular-chandala-glass-embellishment-5-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-20-18-48-58_product_1_1650460738321.jpg?v=1650460748</image:loc>
      <image:title>Aqua Blue Circular Chandala Glass Embellishment- 5 mm</image:title>
      <image:caption>aqua-blue-circular-chandala-glass-embellishment-5-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-grey-circular-chandala-glass-embellishment-5-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-20-18-50-51_product_1_1650460851645.jpg?v=1650460860</image:loc>
      <image:title>Dark Gray Circular Chandala Glass Embellishment- 5 mm</image:title>
      <image:caption>dark-grey-circular-chandala-glass-embellishment-5-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/lct-golden-circular-chandala-glass-embellishment-5-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-20-18-52-32_product_1_1650460952880.jpg?v=1748248827</image:loc>
      <image:title>Oliw mehandi Circular Chandala Glass Embellishment- 5 mm</image:title>
      <image:caption>lct-golden-circular-chandala-glass-embellishment-5-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-blue-circular-chandala-glass-embellishment-6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-20-18-57-39_product_1_1650461259814.jpg?v=1650461268</image:loc>
      <image:title>Dark Blue Circular Chandala Glass Embellishment- 6 mm</image:title>
      <image:caption>dark-blue-circular-chandala-glass-embellishment-6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/purple-circular-chandala-glass-embellishment-6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-20-18-59-12_product_1_1650461352767.jpg?v=1650461361</image:loc>
      <image:title>Purple Circular Chandala Glass Embellishment- 6 mm</image:title>
      <image:caption>purple-circular-chandala-glass-embellishment-6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/topaz-brown-circular-chandala-glass-embellishment-6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-20-19-0-45_product_1_1650461445612.jpg?v=1650461454</image:loc>
      <image:title>Topaz Brown Circular Chandala Glass Embellishment- 6 mm</image:title>
      <image:caption>topaz-brown-circular-chandala-glass-embellishment-6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/olive-green-circular-chandala-glass-embellishment-6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-20-19-2-7_product_1_1650461527500.jpg?v=1650461536</image:loc>
      <image:title>Olive Green Circular Chandala Glass Embellishment- 6 mm</image:title>
      <image:caption>olive-green-circular-chandala-glass-embellishment-6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-gold-designer-metal-suit-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-20-23-53-10_product_1_1650532990339.jpg?v=1650479006</image:loc>
      <image:title>Blue Gold Designer Metal Suit Buttons</image:title>
      <image:caption>blue-gold-designer-metal-suit-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pre-cut-white-sequins-geometric-embroidered-dyeable-pure-georgette-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Dyeable_Pure_White_Georgette_with_Golden_Sequins_Jaal_Allover_product_1_1618145322622_c17adc2b-62e3-4679-9267-ccc8e3b7c7db.jpg?v=1650620163</image:loc>
      <image:title>Precut White Sequins Geometric Embroidered Dyeable Pure Georgette Fabric</image:title>
      <image:caption>dyeable-pure-white-georgette-with-golden-sequins-jaal-allover</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-golden-rectangular-plastic-stones-12x20-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-22-20-18-21_product_1_1650638901233.jpg?v=1650638909</image:loc>
      <image:title>Dark Golden Rectangular Plastic Stones- 12x20 mm</image:title>
      <image:caption>dark-golden-rectangular-plastic-stones-12x20-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-golden-square-plastic-stones-18x21-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-22-20-21-57_product_1_1650639117023.jpg?v=1650639122</image:loc>
      <image:title>Dark Golden Rectangular Plastic Stones- 18x21 mm</image:title>
      <image:caption>dark-golden-square-plastic-stones-18x21-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-golden-square-plastic-stones-10x10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-22-20-23-53_product_1_1650639233678.jpg?v=1650639239</image:loc>
      <image:title>Dark Golden Square Plastic Stones- 10x10 mm</image:title>
      <image:caption>dark-golden-square-plastic-stones-10x10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-golden-square-plastic-stones-12x12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-22-20-25-19_product_1_1650639319894.jpg?v=1650639325</image:loc>
      <image:title>Dark Golden Square Plastic Stones- 12x12 mm</image:title>
      <image:caption>dark-golden-square-plastic-stones-12x12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-golden-drop-plastic-stones-6x12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-22-20-27-2_product_1_1650639422315.jpg?v=1650639427</image:loc>
      <image:title>Dark Golden Drop Plastic Stones- 6x12 mm</image:title>
      <image:caption>dark-golden-drop-plastic-stones-6x12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-golden-diamond-plastic-stones-13x24-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-22-20-29-9_product_1_1650639549710.jpg?v=1650639555</image:loc>
      <image:title>Dark Golden Diamond Plastic Stones- 13x24 mm</image:title>
      <image:caption>dark-golden-diamond-plastic-stones-13x24-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-golden-diamond-plastic-stones-9x15-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-22-20-31-42_product_1_1650639702050.jpg?v=1650639711</image:loc>
      <image:title>Dark Golden Diamond Plastic Stones- 9x15 mm</image:title>
      <image:caption>dark-golden-diamond-plastic-stones-9x15-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-golden-diamond-plastic-stones-8x12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-22-20-33-25_product_1_1650639805476.jpg?v=1650639811</image:loc>
      <image:title>Dark Golden Diamond Plastic Stones- 8x12 mm</image:title>
      <image:caption>dark-golden-diamond-plastic-stones-8x12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-golden-oval-plastic-stones-18x13-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-22-20-35-14_product_1_1650639914647.jpg?v=1650639920</image:loc>
      <image:title>Dark Golden Oval Plastic Stones- 18x13 mm</image:title>
      <image:caption>dark-golden-oval-plastic-stones-18x13-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-golden-oval-plastic-stones-9x15-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-22-20-37-12_product_1_1650640032390.jpg?v=1650640038</image:loc>
      <image:title>Dark Golden Oval Plastic Stones- 9x15 mm</image:title>
      <image:caption>dark-golden-oval-plastic-stones-9x15-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-golden-circular-plastic-stones-6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-22-20-38-55_product_1_1650640135699.jpg?v=1650640141</image:loc>
      <image:title>Dark Golden Circular Plastic Stones- 6 mm</image:title>
      <image:caption>dark-golden-circular-plastic-stones-6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-golden-circular-plastic-stones-8-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-22-20-40-26_product_1_1650640226388.jpg?v=1650640235</image:loc>
      <image:title>Dark Golden Circular Plastic Stones- 8 mm</image:title>
      <image:caption>dark-golden-circular-plastic-stones-8-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-golden-circular-plastic-stones-16-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-22-21-21-20_product_1_1650642680708.jpg?v=1650642693</image:loc>
      <image:title>Dark Golden Circular Plastic Stones- 16 mm</image:title>
      <image:caption>dark-golden-circular-plastic-stones-16-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-golden-circular-plastic-stones-22-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-22-21-22-57_product_1_1650642777093.jpg?v=1650642785</image:loc>
      <image:title>Dark Golden Circular Plastic Stones- 22 mm</image:title>
      <image:caption>dark-golden-circular-plastic-stones-22-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-golden-rectangular-plastic-stones-6x8-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-22-21-25-49_product_1_1650642949601.jpg?v=1650642958</image:loc>
      <image:title>Dark Golden Rectangular Plastic Stones- 6x8 mm</image:title>
      <image:caption>dark-golden-rectangular-plastic-stones-6x8-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-golden-rectangular-plastic-stones-6x15-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-22-21-27-23_product_1_1650643043542.jpg?v=1650643052</image:loc>
      <image:title>Dark Golden Rectangular Plastic Stones- 6x15 mm</image:title>
      <image:caption>dark-golden-rectangular-plastic-stones-6x15-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-golden-rectangular-plastic-stones-6x18-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-22-21-29-37_product_1_1650643177549.jpg?v=1650643186</image:loc>
      <image:title>Dark Golden Rectangular Plastic Stones- 6x18 mm</image:title>
      <image:caption>dark-golden-rectangular-plastic-stones-6x18-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-golden-rectangular-plastic-stones-7x26mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-22-21-32-16_product_1_1650643336763.jpg?v=1650643345</image:loc>
      <image:title>Dark Golden Rectangular Plastic Stones- 7x26mm</image:title>
      <image:caption>dark-golden-rectangular-plastic-stones-7x26mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-golden-rectangular-plastic-stones-12x36mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-22-21-34-12_product_1_1650643452577.jpg?v=1650643464</image:loc>
      <image:title>Dark Golden Rectangular Plastic Stones- 12x36mm</image:title>
      <image:caption>dark-golden-rectangular-plastic-stones-12x36mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-stylish-metal-buttons-for-suit</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-23-1-12-19_product_1_1650710539648.jpg?v=1650656513</image:loc>
      <image:title>Silver Stylish Metal Buttons</image:title>
      <image:caption>silver-stylish-metal-buttons-for-suit</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-lion-beautiful-metal-suit-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-23-10-12-7_product_1_1650742927135.jpg?v=1650688919</image:loc>
      <image:title>Silver Lion Metal Suit Buttons</image:title>
      <image:caption>silver-lion-beautiful-metal-suit-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-circular-2-hole-plastic-beads-8-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-23-13-3-4_product_1_1650699184594.jpg?v=1650699188</image:loc>
      <image:title>Black Circular 2 Hole Plastic Stones - 8 mm</image:title>
      <image:caption>black-circular-2-hole-plastic-beads-8-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-circular-2-hole-plastic-beads-12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-23-13-6-38_product_1_1650699398243.jpg?v=1650699403</image:loc>
      <image:title>Black Circular 2 Hole Plastic Stones - 12 mm</image:title>
      <image:caption>black-circular-2-hole-plastic-beads-12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-circular-2-hole-plastic-beads-14-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-23-13-8-29_product_1_1650699509724.jpg?v=1650699514</image:loc>
      <image:title>Black Circular 2 Hole Plastic Stones - 14 mm</image:title>
      <image:caption>black-circular-2-hole-plastic-beads-14-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-circular-2-hole-plastic-beads-16-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-23-13-10-53_product_1_1650699653855.jpg?v=1650699658</image:loc>
      <image:title>Black Circular 2 Hole Plastic Stones - 16 mm</image:title>
      <image:caption>black-circular-2-hole-plastic-beads-16-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-oval-2-hole-plastic-beads-8x6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-23-13-13-14_product_1_1650699794625.jpg?v=1650699799</image:loc>
      <image:title>Black Oval 2 Hole Plastic Stones - 8x6 mm</image:title>
      <image:caption>black-oval-2-hole-plastic-beads-8x6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-oval-2-hole-plastic-beads-10x14-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-23-13-15-46_product_1_1650699946174.jpg?v=1650699951</image:loc>
      <image:title>Black Oval 2 Hole Plastic Stones - 10x14 mm</image:title>
      <image:caption>black-oval-2-hole-plastic-beads-10x14-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-oval-2-hole-plastic-beads-18x25-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-23-13-19-38_product_1_1650700178651.jpg?v=1650700182</image:loc>
      <image:title>Black Oval 2 Hole Plastic Stones - 18x25 mm</image:title>
      <image:caption>black-oval-2-hole-plastic-beads-18x25-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-square-2-hole-plastic-beads-12x12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-23-13-21-30_product_1_1650700290323.jpg?v=1650700295</image:loc>
      <image:title>Black Square 2 Hole Plastic Stones- 12x12 mm</image:title>
      <image:caption>black-square-2-hole-plastic-beads-12x12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-rectangular-2-hole-plastic-beads-10x14-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-23-13-24-58_product_1_1650700498037.jpg?v=1650700505</image:loc>
      <image:title>Black Rectangular 2 Hole Plastic Stones - 10x14 mm</image:title>
      <image:caption>black-rectangular-2-hole-plastic-beads-10x14-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-octagonal-2-hole-plastic-beads-10x14-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-23-13-26-52_product_1_1650700612419.jpg?v=1650700617</image:loc>
      <image:title>Black Octagonal 2 Hole Plastic Stones - 10x14 mm</image:title>
      <image:caption>black-octagonal-2-hole-plastic-beads-10x14-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-eye-2-hole-plastic-beads-6x12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-23-13-29-1_product_1_1650700741052.jpg?v=1650700746</image:loc>
      <image:title>Black Eye 2 Hole Plastic Stones - 6x12 mm</image:title>
      <image:caption>black-eye-2-hole-plastic-beads-6x12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-eye-2-hole-plastic-beads-9x18-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-23-13-30-57_product_1_1650700857404.jpg?v=1650700862</image:loc>
      <image:title>Black Eye 2 Hole Plastic Stones - 9x18 mm</image:title>
      <image:caption>black-eye-2-hole-plastic-beads-9x18-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-drop-2-hole-plastic-beads-11x18-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-23-13-32-52_product_1_1650700972140.jpg?v=1650700978</image:loc>
      <image:title>Black Drop 2 Hole Plastic Stones- 11x18 mm</image:title>
      <image:caption>black-drop-2-hole-plastic-beads-11x18-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-circular-plastic-beads-without-hole-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-24-18-53-18_product_1_1650806598659.jpg?v=1650806606</image:loc>
      <image:title>Black Circular Plastic Stones Without Hole- 10 mm</image:title>
      <image:caption>black-circular-plastic-beads-without-hole-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-circular-plastic-beads-without-hole-12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-24-18-56-2_product_1_1650806762948.jpg?v=1650806770</image:loc>
      <image:title>Black Circular Plastic Stones Without Hole- 12 mm</image:title>
      <image:caption>black-circular-plastic-beads-without-hole-12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-circular-plastic-beads-without-hole-16-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-24-18-57-56_product_1_1650806876503.jpg?v=1650806884</image:loc>
      <image:title>Black Circular Plastic Stones Without Hole- 16 mm</image:title>
      <image:caption>black-circular-plastic-beads-without-hole-16-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-circular-plastic-beads-without-hole-22-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-24-18-59-28_product_1_1650806968501.jpg?v=1650806977</image:loc>
      <image:title>Black Circular Plastic Stones Without Hole- 22 mm</image:title>
      <image:caption>black-circular-plastic-beads-without-hole-22-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-drop-plastic-beads-without-hole-10x14-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-24-19-4-0_product_1_1650807240823.jpg?v=1650807247</image:loc>
      <image:title>Black Drop Plastic Stones Without Hole- 10x14 mm</image:title>
      <image:caption>black-drop-plastic-beads-without-hole-10x14-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-drop-plastic-beads-without-hole-12x16-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-24-19-29-37_product_1_1650808777590.jpg?v=1650808786</image:loc>
      <image:title>Black Drop Plastic Stones Without Hole- 12x16 mm</image:title>
      <image:caption>black-drop-plastic-beads-without-hole-12x16-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-square-plastic-beads-without-hole-18x16-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-24-19-39-45_product_1_1650809385043.jpg?v=1650809392</image:loc>
      <image:title>Black Rectangular Plastic Stones Without Hole- 18x16 mm</image:title>
      <image:caption>black-square-plastic-beads-without-hole-18x16-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-square-plastic-beads-without-hole-8x6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-24-19-42-28_product_1_1650809548988.jpg?v=1650809557</image:loc>
      <image:title>Black Rectangular Plastic Stones Without Hole- 8x6 mm</image:title>
      <image:caption>black-square-plastic-beads-without-hole-8x6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-reactangular-plastic-beads-without-hole-6x18-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-24-19-46-24_product_1_1650809784786.jpg?v=1650809792</image:loc>
      <image:title>Black Rectangular Plastic Stones Without Hole- 6x18 mm</image:title>
      <image:caption>black-reactangular-plastic-beads-without-hole-6x18-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-rectangular-plastic-beads-without-hole-6x26-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-24-19-48-48_product_1_1650809928407.jpg?v=1650809936</image:loc>
      <image:title>Black Rectangular Plastic Stones Without Hole- 6x26 mm</image:title>
      <image:caption>black-rectangular-plastic-beads-without-hole-6x26-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-rectangular-plastic-beads-without-hole-20x12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-24-19-50-47_product_1_1650810047887.jpg?v=1650810056</image:loc>
      <image:title>Black Rectangular Plastic Stones Without Hole- 20x12 mm</image:title>
      <image:caption>black-rectangular-plastic-beads-without-hole-20x12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-oval-plastic-beads-without-hole-18x13-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-24-19-57-16_product_1_1650810436285.jpg?v=1650810444</image:loc>
      <image:title>Black Oval Plastic Stones Without Hole- 18x13 mm</image:title>
      <image:caption>black-oval-plastic-beads-without-hole-18x13-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-oval-plastic-beads-without-hole-9x16-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-24-19-58-54_product_1_1650810534663.jpg?v=1650810544</image:loc>
      <image:title>Black Oval Plastic Stones Without Hole- 9x16 mm</image:title>
      <image:caption>black-oval-plastic-beads-without-hole-9x16-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-oval-plastic-beads-without-hole-8x12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-24-20-0-40_product_1_1650810640477.jpg?v=1650810648</image:loc>
      <image:title>Black Diamond Plastic Stones Without Hole- 8x12 mm</image:title>
      <image:caption>black-oval-plastic-beads-without-hole-8x12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-diamond-plastic-beads-without-hole-20x27-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-24-20-10-12_product_1_1650811212932.jpg?v=1650811220</image:loc>
      <image:title>Black Diamond Plastic Stone Without Hole- 20x27 mm</image:title>
      <image:caption>black-diamond-plastic-beads-without-hole-20x27-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-diamond-plastic-beads-without-hole-8x16-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-24-20-12-53_product_1_1650811373813.jpg?v=1650811384</image:loc>
      <image:title>Black Diamond Plastic Stones Without Hole- 8x16 mm</image:title>
      <image:caption>black-diamond-plastic-beads-without-hole-8x16-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-rainbow-oval-2-hole-plastic-stones-10x14-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-24-20-23-18_product_1_1650811998772.jpg?v=1650812007</image:loc>
      <image:title>Golden Rainbow Oval 2 Hole Plastic Stones- 10x14 mm</image:title>
      <image:caption>golden-rainbow-oval-2-hole-plastic-stones-10x14-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-rainbow-oval-2-hole-plastic-stones-18x13-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-24-20-25-7_product_1_1650812107509.jpg?v=1650812116</image:loc>
      <image:title>Golden Rainbow Oval 2 Hole Plastic Stones- 18x13 mm</image:title>
      <image:caption>golden-rainbow-oval-2-hole-plastic-stones-18x13-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-rainbow-square-2-hole-plastic-stones-12x12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-24-20-32-28_product_1_1650812548678.jpg?v=1650812557</image:loc>
      <image:title>Golden Rainbow Square 2 Hole Plastic Stones- 12x12 mm</image:title>
      <image:caption>golden-rainbow-square-2-hole-plastic-stones-12x12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-rainbow-circular-2-hole-plastic-stones-12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-24-20-34-3_product_1_1650812643219.jpg?v=1650812652</image:loc>
      <image:title>Golden Rainbow Circular 2 Hole Plastic Stones- 12 mm</image:title>
      <image:caption>golden-rainbow-circular-2-hole-plastic-stones-12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-rainbow-triangular-2-hole-plastic-stones-16x16-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-24-20-35-44_product_1_1650812744137.jpg?v=1650812752</image:loc>
      <image:title>Golden Rainbow Triangular 2 Hole Plastic Stones- 16x16 mm</image:title>
      <image:caption>golden-rainbow-triangular-2-hole-plastic-stones-16x16-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ferozi-color-rectangle-shape-plastic-sequins-sitara-sippi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-17-15-0_product_1_1650887100653.jpg?v=1650887105</image:loc>
      <image:title>Ferozi Blue Rectangle Plastic Sequins/Sitara/Sippi</image:title>
      <image:caption>ferozi-color-rectangle-shape-plastic-sequins-sitara-sippi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multi-color-paan-shape-plastic-sequins-sitara-sippi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-17-31-23_product_1_1650888083437.jpg?v=1650888087</image:loc>
      <image:title>Multicolour Paan Plastic Sequins/Sitara/Sippi</image:title>
      <image:caption>multi-color-paan-shape-plastic-sequins-sitara-sippi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-color-round-shape-plastic-sequins-sitara-sippi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-17-37-24_product_1_1650888444130.jpg?v=1650888448</image:loc>
      <image:title>Peach Round Plastic Sequins/Sitara/Sippi</image:title>
      <image:caption>peach-color-round-shape-plastic-sequins-sitara-sippi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/rose-gold-color-leaf-shape-plastic-sequins-sitara-sippi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-17-44-55_product_1_1650888895882.jpg?v=1650888900</image:loc>
      <image:title>Rose Gold Leaf Plastic Sequins/Sitara/Sippi</image:title>
      <image:caption>rose-gold-color-leaf-shape-plastic-sequins-sitara-sippi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-color-rectangle-shape-plastic-sequins</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-17-46-16_product_1_1650888976142.jpg?v=1650888980</image:loc>
      <image:title>Yellow Rectangle Plastic Sequins</image:title>
      <image:caption>yellow-color-rectangle-shape-plastic-sequins</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-color-round-shape-plastic-sequins</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-17-47-35_product_1_1650889055105.jpg?v=1650889059</image:loc>
      <image:title>Yellow Round Plastic Sequins</image:title>
      <image:caption>yellow-color-round-shape-plastic-sequins</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-circular-plastic-stones-with-hole-6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-19-59-49_product_1_1650896989690.jpg?v=1650896998</image:loc>
      <image:title>Green Circular Plastic Stones Without Hole- 6 mm</image:title>
      <image:caption>green-circular-plastic-stones-with-hole-6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-eye-plastic-stones-without-hole-15x7-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-20-3-49_product_1_1650897229027.jpg?v=1650897240</image:loc>
      <image:title>Green Eye Plastic Stones Without Hole- 15x7 mm</image:title>
      <image:caption>green-eye-plastic-stones-without-hole-15x7-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-octagonal-plastic-stones-without-hole-18x13-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-20-7-56_product_1_1650897476654.jpg?v=1650897486</image:loc>
      <image:title>Green Octagonal Plastic Stones Without Hole- 18x13 mm</image:title>
      <image:caption>green-octagonal-plastic-stones-without-hole-18x13-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/olive-green-oval-plastic-stones-without-hole-18x13-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-20-13-56_product_1_1650897836700.jpg?v=1650897848</image:loc>
      <image:title>Olive Green Oval Plastic Stones Without Hole- 18x13 mm</image:title>
      <image:caption>olive-green-oval-plastic-stones-without-hole-18x13-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-olive-green-octagonal-plastic-stones-without-hole-18x13-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-20-16-7_product_1_1650897967333.jpg?v=1650897973</image:loc>
      <image:title>Dark Olive Green Octagonal Plastic Stones Without Hole- 18x13 mm</image:title>
      <image:caption>dark-olive-green-octagonal-plastic-stones-without-hole-18x13-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-yellow-circular-plastic-stones-without-hole-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-20-18-23_product_1_1650898103541.jpg?v=1650898109</image:loc>
      <image:title>Light Yellow Circular Plastic Stones Without Hole- 10 mm</image:title>
      <image:caption>light-yellow-circular-plastic-stones-without-hole-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-yellow-square-plastic-stones-without-hole-8x8-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-20-22-38_product_1_1650898358101.jpg?v=1650898366</image:loc>
      <image:title>Light Yellow Square Plastic Stones Without Hole- 8x8 mm</image:title>
      <image:caption>light-yellow-square-plastic-stones-without-hole-8x8-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-yellow-square-plastic-stones-without-hole-10x10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-20-25-18_product_1_1650898518249.jpg?v=1650898530</image:loc>
      <image:title>Light Yellow Square Plastic Stones Without Hole- 10x10 mm</image:title>
      <image:caption>light-yellow-square-plastic-stones-without-hole-10x10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-yellow-rectangular-2-hole-plastic-stones-18x13-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-20-28-5_product_1_1650898685677.jpg?v=1650898693</image:loc>
      <image:title>Light Yellow Rectangular 2 Hole Plastic Stones - 18x13 mm</image:title>
      <image:caption>light-yellow-rectangular-2-hole-plastic-stones-18x13-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-yellow-oval-plastic-stones-without-hole-18x13-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-20-31-34_product_1_1650898894298.jpg?v=1650898901</image:loc>
      <image:title>Light Yellow Oval Plastic Stones Without Hole- 18x13 mm</image:title>
      <image:caption>light-yellow-oval-plastic-stones-without-hole-18x13-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-circular-plastic-stones-without-hole-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-20-34-13_product_1_1650899053439.jpg?v=1650899061</image:loc>
      <image:title>Blue Circular Plastic Stones Without Hole- 10 mm</image:title>
      <image:caption>blue-circular-plastic-stones-without-hole-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-circular-plastic-stones-without-hole-16-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-20-36-3_product_1_1650899163947.jpg?v=1650899171</image:loc>
      <image:title>Yellow Circular Plastic Stones Without Hole- 16 mm</image:title>
      <image:caption>yellow-circular-plastic-stones-without-hole-16-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-drop-2-hole-plastic-stones-30x20-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-20-38-23_product_1_1650899303813.jpg?v=1650899310</image:loc>
      <image:title>Yellow Drop 2 Hole Plastic Stones - 30x20 mm</image:title>
      <image:caption>yellow-drop-2-hole-plastic-stones-30x20-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-circular-2-hole-plastic-stones-16-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-20-40-45_product_1_1650899445423.jpg?v=1650899453</image:loc>
      <image:title>Yellow Circular 2 Hole Plastic Stones - 16 mm</image:title>
      <image:caption>yellow-circular-2-hole-plastic-stones-16-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-yellow-rectangular-2-hole-plastic-stones-25x18-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-20-43-7_product_1_1650899587141.jpg?v=1650899593</image:loc>
      <image:title>Dark Yellow Rectangular 2 Hole Plastic Stones - 25x18 mm</image:title>
      <image:caption>dark-yellow-rectangular-2-hole-plastic-stones-25x18-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cream-octagonal-2-hole-plastic-stones-18x13-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-20-47-1_product_1_1650899821775.jpg?v=1650899831</image:loc>
      <image:title>Cream Octagonal 2 Hole Plastic Stones - 18x13 mm</image:title>
      <image:caption>cream-octagonal-2-hole-plastic-stones-18x13-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-oval-plastic-stones-without-hole-25x18-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-20-51-16_product_1_1650900076522.jpg?v=1650900082</image:loc>
      <image:title>Peach Oval Plastic Stones Without Hole - 25x18 mm</image:title>
      <image:caption>peach-oval-plastic-stones-without-hole-25x18-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-octagonal-plastic-stones-without-hole-18x13-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-20-54-54_product_1_1650900294945.jpg?v=1650900301</image:loc>
      <image:title>Peach Octagonal Plastic Stones Without Hole - 18x13 mm</image:title>
      <image:caption>peach-octagonal-plastic-stones-without-hole-18x13-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-square-plastic-stones-without-hole-8x8-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-20-59-35_product_1_1650900575623.jpg?v=1650900584</image:loc>
      <image:title>Peach Square Plastic Stones Without Hole - 8x8 mm</image:title>
      <image:caption>peach-square-plastic-stones-without-hole-8x8-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/purple-oval-plastic-stones-without-hole-18x13-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-21-1-42_product_1_1650900702895.jpg?v=1650900709</image:loc>
      <image:title>Purple Oval Plastic Stones Without Hole - 18x13 mm</image:title>
      <image:caption>purple-oval-plastic-stones-without-hole-18x13-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-pink-circular-stones-without-hole-16-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-21-3-28_product_1_1650900808659.jpg?v=1650900821</image:loc>
      <image:title>Dark Pink Circular Stones Without Hole - 16 mm</image:title>
      <image:caption>dark-pink-circular-stones-without-hole-16-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/aqua-blue-drop-2-hole-plastic-stone-11x18-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-21-10-23_product_1_1650901223878.jpg?v=1650901230</image:loc>
      <image:title>Aqua Blue Drop 2 Hole Plastic Stone - 11x18 mm</image:title>
      <image:caption>aqua-blue-drop-2-hole-plastic-stone-11x18-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/aqua-blue-drop-2-hole-plastic-stone-30x20-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-21-12-9_product_1_1650901329445.jpg?v=1650901334</image:loc>
      <image:title>Aqua Blue Drop 2 Hole Plastic Stone - 30x20 mm</image:title>
      <image:caption>aqua-blue-drop-2-hole-plastic-stone-30x20-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/aqua-blue-oval-2-hole-plastic-stone-18x13-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-21-14-20_product_1_1650901460829.jpg?v=1650901469</image:loc>
      <image:title>Aqua Blue Oval 2 Hole Plastic Stone - 18x13 mm</image:title>
      <image:caption>aqua-blue-oval-2-hole-plastic-stone-18x13-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/aqua-blue-oval-2-hole-plastic-stone-18x25-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-21-16-8_product_1_1650901568340.jpg?v=1650901575</image:loc>
      <image:title>Aqua Blue Oval 2 Hole Plastic Stone - 18x25 mm</image:title>
      <image:caption>aqua-blue-oval-2-hole-plastic-stone-18x25-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-blue-oval-plastic-stones-without-hole-30x20-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-21-19-4_product_1_1650901744140.jpg?v=1650901751</image:loc>
      <image:title>Dark Blue Oval Plastic Stones Without Hole -30x20 mm</image:title>
      <image:caption>dark-blue-oval-plastic-stones-without-hole-30x20-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-blue-oval-plastic-stones-without-hole-30x40-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-21-20-48_product_1_1650901848468.jpg?v=1650901856</image:loc>
      <image:title>Dark Blue Oval Plastic Stones Without Hole -30x40 mm</image:title>
      <image:caption>dark-blue-oval-plastic-stones-without-hole-30x40-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/aqua-blue-eye-2-hole-plastic-stone-6x12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-21-22-51_product_1_1650901971750.jpg?v=1650901978</image:loc>
      <image:title>Aqua Blue Eye 2 Hole Plastic Stone -6x12 mm</image:title>
      <image:caption>aqua-blue-eye-2-hole-plastic-stone-6x12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/aqua-blue-uneven-2-hole-plastic-stone-20x14-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-21-24-28_product_1_1650902068457.jpg?v=1650902074</image:loc>
      <image:title>Aqua Blue Uneven 2 Hole Plastic Stone -20x14 mm</image:title>
      <image:caption>aqua-blue-uneven-2-hole-plastic-stone-20x14-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/aqua-blue-rectangular-2-hole-plastic-stone-6x18-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-21-26-24_product_1_1650902184558.jpg?v=1650902192</image:loc>
      <image:title>Aqua Blue Rectangular 2 Hole Plastic Stone - 6x18 mm</image:title>
      <image:caption>aqua-blue-rectangular-2-hole-plastic-stone-6x18-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/aqua-blue-rectangular-2-hole-plastic-stone-8x24-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-25-21-28-43_product_1_1650902323318.jpg?v=1650902331</image:loc>
      <image:title>Aqua Blue Rectangular 2 Hole Plastic Stone - 8x24 mm</image:title>
      <image:caption>aqua-blue-rectangular-2-hole-plastic-stone-8x24-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/metallic-light-pink-color-round-shape-plastic-sequins</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-26-12-11-57_product_1_1650955317461.jpg?v=1650955322</image:loc>
      <image:title>Metallic Light Pink Round Plastic Sequins</image:title>
      <image:caption>metallic-light-pink-color-round-shape-plastic-sequins</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ferozi-color-oval-shape-plastic-sequins</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-26-12-13-5_product_1_1650955385664.jpg?v=1650955389</image:loc>
      <image:title>Ferozi Blue Oval Plastic Sequins</image:title>
      <image:caption>ferozi-color-oval-shape-plastic-sequins</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/purple-sparkle-color-square-shape-plastic-sequins</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-26-12-14-44_product_1_1650955484438.jpg?v=1650955488</image:loc>
      <image:title>Purple Sparkle Square Plastic Sequins</image:title>
      <image:caption>purple-sparkle-color-square-shape-plastic-sequins</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-golden-color-pentagonal-shape-plastic-sequins-sitara-sippi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-26-12-16-56_product_1_1650955616247.jpg?v=1650955621</image:loc>
      <image:title>Light Golden Pentagonal Plastic Sequins/ Sitara/Sippi</image:title>
      <image:caption>light-golden-color-pentagonal-shape-plastic-sequins-sitara-sippi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-color-color-round-shape-plastic-sequins-sitara-sippi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-26-12-18-29_product_1_1650955709873.jpg?v=1650955715</image:loc>
      <image:title>Golden Round Plastic Sequins/ Sitara/Sippi</image:title>
      <image:caption>golden-color-color-round-shape-plastic-sequins-sitara-sippi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-green-color-square-shape-plastic-sequins-sitara-sippi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-26-12-23-27_product_1_1650956007668.jpg?v=1650956012</image:loc>
      <image:title>Light Green Square Plastic Sequins/ Sitara/Sippi</image:title>
      <image:caption>light-green-color-square-shape-plastic-sequins-sitara-sippi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/orange-color-eye-shape-plastic-sequins-sitara-sippi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-26-12-26-56_product_1_1650956216391.jpg?v=1650956220</image:loc>
      <image:title>Orange Eye Plastic Sequins/ Sitara/Sippi</image:title>
      <image:caption>orange-color-eye-shape-plastic-sequins-sitara-sippi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/neon-orange-circular-2-hole-plastic-stone-12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-26-22-14-41_product_1_1650991481185.jpg?v=1650991489</image:loc>
      <image:title>Neon Orange Circular 2 Hole Plastic Stone-12 mm</image:title>
      <image:caption>neon-orange-circular-2-hole-plastic-stone-12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/neon-orange-drop-2-hole-plastic-stone-10x18-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-26-22-17-30_product_1_1650991650274.jpg?v=1650991669</image:loc>
      <image:title>Neon Orange Drop 2 Hole Plastic Stone- 10x18 mm</image:title>
      <image:caption>neon-orange-drop-2-hole-plastic-stone-10x18-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/neon-orange-drop-2-hole-plastic-stone-18x5-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-26-22-20-12_product_1_1650991812139.jpg?v=1650991818</image:loc>
      <image:title>Neon Orange Drop 2 Hole Plastic Stone- 18x5 mm</image:title>
      <image:caption>neon-orange-drop-2-hole-plastic-stone-18x5-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/neon-orange-drop-2-hole-plastic-stone-30x20-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-26-22-23-50_product_1_1650992030701.jpg?v=1650992039</image:loc>
      <image:title>Neon Orange Drop 2 Hole Plastic Stone- 30x20 mm</image:title>
      <image:caption>neon-orange-drop-2-hole-plastic-stone-30x20-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/neon-orange-oval-2-hole-plastic-stone-18x25-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-26-22-29-0_product_1_1650992340652.jpg?v=1650992354</image:loc>
      <image:title>Neon Orange Oval 2 Hole Plastic Stone- 18x25 mm</image:title>
      <image:caption>neon-orange-oval-2-hole-plastic-stone-18x25-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/neon-orange-uneven-2-hole-plastic-stone-20x12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-26-22-31-57_product_1_1650992517798.jpg?v=1650992530</image:loc>
      <image:title>Neon Orange Uneven 2 Hole Plastic Stone- 20x12 mm</image:title>
      <image:caption>neon-orange-uneven-2-hole-plastic-stone-20x12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/neon-orange-rectangular-2-hole-plastic-stone-8x24-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-26-22-35-32_product_1_1650992732771.jpg?v=1650992743</image:loc>
      <image:title>Neon Orange Rectangular 2 Hole Plastic Stone- 8x24 mm</image:title>
      <image:caption>neon-orange-rectangular-2-hole-plastic-stone-8x24-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/neon-orange-circular-plastic-stone-without-hole-12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-26-22-37-56_product_1_1650992876959.jpg?v=1650992883</image:loc>
      <image:title>Neon Orange Circular Plastic Stone Without Hole- 12 mm</image:title>
      <image:caption>neon-orange-circular-plastic-stone-without-hole-12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/neon-orange-square-plastic-stone-without-hole-10x10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-26-22-40-19_product_1_1650993019553.jpg?v=1650993026</image:loc>
      <image:title>Neon Orange Square Plastic Stone Without Hole- 10x10 mm</image:title>
      <image:caption>neon-orange-square-plastic-stone-without-hole-10x10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/neon-yellow-circular-2-hole-plastic-stone-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-26-22-42-52_product_1_1650993172844.jpg?v=1650993179</image:loc>
      <image:title>Neon Yellow Circular 2 Hole Plastic Stone- 10 mm</image:title>
      <image:caption>neon-yellow-circular-2-hole-plastic-stone-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/neon-yellow-circular-2-hole-plastic-stone-12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-26-22-45-1_product_1_1650993301183.jpg?v=1650993308</image:loc>
      <image:title>Neon Yellow Circular 2 Hole Plastic Stone- 12 mm</image:title>
      <image:caption>neon-yellow-circular-2-hole-plastic-stone-12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/neon-yellow-uneven-2-hole-plastic-stone-20x12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-26-22-47-6_product_1_1650993426449.jpg?v=1650993435</image:loc>
      <image:title>Neon Yellow Uneven 2 Hole Plastic Stone- 20x12 mm</image:title>
      <image:caption>neon-yellow-uneven-2-hole-plastic-stone-20x12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/neon-yellow-oval-2-hole-plastic-stone-8x18-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-26-22-49-12_product_1_1650993552916.jpg?v=1650993567</image:loc>
      <image:title>Neon Yellow Oval 2 Hole Plastic Stone- 8x18 mm</image:title>
      <image:caption>neon-yellow-oval-2-hole-plastic-stone-8x18-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/neon-yellow-oval-2-hole-plastic-stone-18x25-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-26-22-51-20_product_1_1650993680772.jpg?v=1650993694</image:loc>
      <image:title>Neon Yellow Oval 2 Hole Plastic Stone- 18x25 mm</image:title>
      <image:caption>neon-yellow-oval-2-hole-plastic-stone-18x25-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/neon-yellow-oval-plastic-stone-without-hole-16x13-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-10-39-14_product_1_1651036154723.jpg?v=1651036161</image:loc>
      <image:title>Neon Yellow Oval Plastic Stone Without Hole- 16x13 mm</image:title>
      <image:caption>neon-yellow-oval-plastic-stone-without-hole-16x13-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/neon-yellow-drop-2-hole-plastic-stone-18x25-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-10-48-21_product_1_1651036701940.jpg?v=1651036707</image:loc>
      <image:title>Neon Yellow Drop 2 Hole Plastic Stone- 18x25 mm</image:title>
      <image:caption>neon-yellow-drop-2-hole-plastic-stone-18x25-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/neon-yellow-drop-2-hole-plastic-stone-30x20-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-10-50-34_product_1_1651036834343.jpg?v=1651036840</image:loc>
      <image:title>Neon Yellow Drop 2 Hole Plastic Stone- 30x20 mm</image:title>
      <image:caption>neon-yellow-drop-2-hole-plastic-stone-30x20-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/neon-yellow-rectangular-2-hole-plastic-stone-6x18-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-10-52-13_product_1_1651036933155.jpg?v=1651036941</image:loc>
      <image:title>Neon Yellow Rectangular 2 Hole Plastic Stone- 6x18 mm</image:title>
      <image:caption>neon-yellow-rectangular-2-hole-plastic-stone-6x18-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/neon-yellow-rectangular-2-hole-plastic-stone-8x24-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-10-54-4_product_1_1651037044223.jpg?v=1651037049</image:loc>
      <image:title>Neon Yellow Rectangular 2 Hole Plastic Stone- 8x24 mm</image:title>
      <image:caption>neon-yellow-rectangular-2-hole-plastic-stone-8x24-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-neon-yellow-oval-2-hole-plastic-stone-18x25-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-10-55-56_product_1_1651037156012.jpg?v=1651037163</image:loc>
      <image:title>Dark Neon Yellow Oval 2 Hole Plastic Stone- 18x25 mm</image:title>
      <image:caption>dark-neon-yellow-oval-2-hole-plastic-stone-18x25-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-neon-yellow-drop-2-hole-plastic-stone-18x25-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-10-58-21_product_1_1651037301572.jpg?v=1651037307</image:loc>
      <image:title>Dark Neon Yellow Drop 2 Hole Plastic Stone- 18x25 mm</image:title>
      <image:caption>dark-neon-yellow-drop-2-hole-plastic-stone-18x25-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-neon-yellow-drop-2-hole-plastic-stone-30x20-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-11-1-21_product_1_1651037481923.jpg?v=1651037497</image:loc>
      <image:title>Dark Neon Yellow Drop 2 Hole Plastic Stone- 30x20 mm</image:title>
      <image:caption>dark-neon-yellow-drop-2-hole-plastic-stone-30x20-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-neon-yellow-uneven-2-hole-plastic-stone-20x12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-11-3-13_product_1_1651037593701.jpg?v=1651037603</image:loc>
      <image:title>Dark Neon Yellow Uneven 2 Hole Plastic Stone- 20x12 mm</image:title>
      <image:caption>dark-neon-yellow-uneven-2-hole-plastic-stone-20x12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-neon-yellow-rectangular-2-hole-plastic-stone-8x24-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-11-4-57_product_1_1651037697597.jpg?v=1651037707</image:loc>
      <image:title>Dark Neon Yellow Rectangular 2 Hole Plastic Stone- 8x24 mm</image:title>
      <image:caption>dark-neon-yellow-rectangular-2-hole-plastic-stone-8x24-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/neon-green-circular-2-hole-plastic-stone-8-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-13-27-22_product_1_1651046242541.jpg?v=1651046255</image:loc>
      <image:title>Neon Green Circular 2 Hole Plastic Stone- 8 mm</image:title>
      <image:caption>neon-green-circular-2-hole-plastic-stone-8-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/neon-green-circular-2-hole-plastic-stone-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-13-28-51_product_1_1651046331757.jpg?v=1651046352</image:loc>
      <image:title>Neon Green Circular 2 Hole Plastic Stone- 10 mm</image:title>
      <image:caption>neon-green-circular-2-hole-plastic-stone-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/neon-green-circular-2-hole-plastic-stone-12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-13-30-35_product_1_1651046435162.jpg?v=1651046453</image:loc>
      <image:title>Neon Green Circular 2 Hole Plastic Stone- 12 mm</image:title>
      <image:caption>neon-green-circular-2-hole-plastic-stone-12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/neon-green-oval-2-hole-plastic-stone-18x10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-13-32-24_product_1_1651046544863.jpg?v=1651046558</image:loc>
      <image:title>Neon Green Oval 2 Hole Plastic Stone- 18x10 mm</image:title>
      <image:caption>neon-green-oval-2-hole-plastic-stone-18x10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/neon-green-oval-2-hole-plastic-stone-18x25-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-13-33-51_product_1_1651046631632.jpg?v=1651046649</image:loc>
      <image:title>Neon Green Oval 2 Hole Plastic Stone- 18x25 mm</image:title>
      <image:caption>neon-green-oval-2-hole-plastic-stone-18x25-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/neon-green-drop-2-hole-plastic-stone-18x25-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-13-35-19_product_1_1651046719626.jpg?v=1651046734</image:loc>
      <image:title>Neon Green Drop 2 Hole Plastic Stone- 18x25 mm</image:title>
      <image:caption>neon-green-drop-2-hole-plastic-stone-18x25-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/neon-green-drop-2-hole-plastic-stone-30x20-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-13-36-50_product_1_1651046810634.jpg?v=1651046824</image:loc>
      <image:title>Neon Green Drop 2 Hole Plastic Stone- 30x20 mm</image:title>
      <image:caption>neon-green-drop-2-hole-plastic-stone-30x20-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/neon-green-uneven-2-hole-plastic-stone-20x12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-13-38-25_product_1_1651046905387.jpg?v=1651046921</image:loc>
      <image:title>Neon Green Uneven 2 Hole Plastic Stone- 20x12 mm</image:title>
      <image:caption>neon-green-uneven-2-hole-plastic-stone-20x12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/neon-green-rectangular-2-hole-plastic-stone-8x24-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-13-40-13_product_1_1651047013208.jpg?v=1651047034</image:loc>
      <image:title>Neon Green Rectangular 2 Hole Plastic Stone- 8x24 mm</image:title>
      <image:caption>neon-green-rectangular-2-hole-plastic-stone-8x24-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-circular-2-hole-plastic-stone-8-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-13-44-30_product_1_1651047270421.jpg?v=1651047319</image:loc>
      <image:title>Pink Circular 2 Hole Plastic Stone- 8 mm</image:title>
      <image:caption>pink-circular-2-hole-plastic-stone-8-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-circular-2-hole-plastic-stone-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-13-47-29_product_1_1651047449949.jpg?v=1651047476</image:loc>
      <image:title>Pink Circular 2 Hole Plastic Stone- 10 mm</image:title>
      <image:caption>pink-circular-2-hole-plastic-stone-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-eye-2-hole-plastic-stone-6x12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-13-56-34_product_1_1651047994408.jpg?v=1651048057</image:loc>
      <image:title>Pink Eye 2 Hole Plastic Stone- 6x12 mm</image:title>
      <image:caption>pink-eye-2-hole-plastic-stone-6x12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-uneven-2-hole-plastic-stone-20x12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-13-59-6_product_1_1651048146197.jpg?v=1651048176</image:loc>
      <image:title>Pink Uneven 2 Hole Plastic Stone- 20x12 mm</image:title>
      <image:caption>pink-uneven-2-hole-plastic-stone-20x12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-uneven-2-hole-plastic-stone-18x25-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-14-6-55_product_1_1651048615257.jpg?v=1651048636</image:loc>
      <image:title>Pink Oval 2 Hole Plastic Stone- 18x25 mm</image:title>
      <image:caption>pink-uneven-2-hole-plastic-stone-18x25-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-drop-2-hole-plastic-stone-18x25-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-14-10-20_product_1_1651048820757.jpg?v=1651048845</image:loc>
      <image:title>Pink Drop 2 Hole Plastic Stone- 18x25 mm</image:title>
      <image:caption>pink-drop-2-hole-plastic-stone-18x25-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-rectangular-2-hole-plastic-stone-8x25-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-14-13-51_product_1_1651049031827.jpg?v=1651049051</image:loc>
      <image:title>Pink Rectangular 2 Hole Plastic Stone- 8x25 mm</image:title>
      <image:caption>pink-rectangular-2-hole-plastic-stone-8x25-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-drop-2-hole-plastic-stone-9x18-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-20-59-57_product_1_1651073397399.jpg?v=1651073404</image:loc>
      <image:title>Golden Drop 2 Hole Plastic Stone- 9x18 mm</image:title>
      <image:caption>golden-drop-2-hole-plastic-stone-9x18-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-rectangular-2-hole-plastic-stone-10x14-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-21-1-55_product_1_1651073515468.jpg?v=1651073521</image:loc>
      <image:title>Golden Rectangular 2 Hole Plastic Stone- 10x14 mm</image:title>
      <image:caption>golden-rectangular-2-hole-plastic-stone-10x14-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-octagonal-2-hole-plastic-stone-10x14-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-21-7-7_product_1_1651073827354.jpg?v=1651073834</image:loc>
      <image:title>Golden Octagonal 2 Hole Plastic Stone- 10x14 mm</image:title>
      <image:caption>golden-octagonal-2-hole-plastic-stone-10x14-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-octagonal-2-hole-plastic-stone-18x25-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-21-10-20_product_1_1651074020770.jpg?v=1651074029</image:loc>
      <image:title>Golden Octagonal 2 Hole Plastic Stone- 18x25 mm</image:title>
      <image:caption>golden-octagonal-2-hole-plastic-stone-18x25-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-triangular-2-hole-plastic-stone-22x22-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-21-13-7_product_1_1651074187065.jpg?v=1651074193</image:loc>
      <image:title>Golden Triangular 2 Hole Plastic Stone- 22x22 mm</image:title>
      <image:caption>golden-triangular-2-hole-plastic-stone-22x22-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-rectangular-2-hole-plastic-stone-14x30-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-21-17-47_product_1_1651074467736.jpg?v=1651074474</image:loc>
      <image:title>Golden Rectangular 2 Hole Plastic Stone- 14x30 mm</image:title>
      <image:caption>golden-rectangular-2-hole-plastic-stone-14x30-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-rectangular-2-hole-plastic-stone-7x21-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-21-19-51_product_1_1651074591779.jpg?v=1651074598</image:loc>
      <image:title>Golden Rectangular 2 Hole Plastic Stone- 7x21 mm</image:title>
      <image:caption>golden-rectangular-2-hole-plastic-stone-7x21-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-eye-2-hole-plastic-stone-11x24-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-21-22-4_product_1_1651074724081.jpg?v=1651074734</image:loc>
      <image:title>Golden Eye 2 Hole Plastic Stone- 11x24 mm</image:title>
      <image:caption>golden-eye-2-hole-plastic-stone-11x24-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-eye-2-hole-plastic-stone-9x26-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-27-21-24-20_product_1_1651074860607.jpg?v=1651074867</image:loc>
      <image:title>Golden Eye 2 Hole Plastic Stone- 9x26 mm</image:title>
      <image:caption>golden-eye-2-hole-plastic-stone-9x26-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-rectangular-2-hole-plastic-stone-30x10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-28-11-14-50_product_1_1651124690653.jpg?v=1651124697</image:loc>
      <image:title>Golden Rectangular 2 Hole Plastic Stone- 30x10 mm</image:title>
      <image:caption>golden-rectangular-2-hole-plastic-stone-30x10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-oval-2-hole-plastic-stone-18x25-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-28-11-24-15_product_1_1651125255253.jpg?v=1651125260</image:loc>
      <image:title>Golden Oval 2 Hole Plastic Stone- 18x25 mm</image:title>
      <image:caption>golden-oval-2-hole-plastic-stone-18x25-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-golden-circular-2-hole-plastic-stone-12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-28-11-25-58_product_1_1651125358742.jpg?v=1651125365</image:loc>
      <image:title>Dark Golden Circular 2 Hole Plastic Stone- 12 mm</image:title>
      <image:caption>dark-golden-circular-2-hole-plastic-stone-12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/deep-golden-circular-2-hole-plastic-stone-12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-28-11-32-38_product_1_1651125758325.jpg?v=1651125764</image:loc>
      <image:title>Deep Golden Circular 2 Hole Plastic Stone- 12 mm</image:title>
      <image:caption>deep-golden-circular-2-hole-plastic-stone-12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-golden-color-round-shape-plastic-sequins-sitara-sippi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-28-11-53-11_product_1_1651126991996.jpg?v=1651126997</image:loc>
      <image:title>Light Golden Round Plastic Sequins</image:title>
      <image:caption>light-golden-color-round-shape-plastic-sequins-sitara-sippi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dull-golden-color-round-shape-plastic-sequins-sitara-sippi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-28-11-57-15_product_1_1651127235948.jpg?v=1651127241</image:loc>
      <image:title>Dull Golden Round Plastic Sequins/Sitara/Sippi</image:title>
      <image:caption>dull-golden-color-round-shape-plastic-sequins-sitara-sippi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-color-oval-shape-plastic-sequins</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-28-12-39-11_product_1_1651129751186.jpg?v=1651129757</image:loc>
      <image:title>White Oval Plastic Sequins</image:title>
      <image:caption>white-color-oval-shape-plastic-sequins</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ferozi-color-ring-shape-plastic-sequins</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-28-12-40-51_product_1_1651129851402.jpg?v=1651129857</image:loc>
      <image:title>Ferozi Blue Ring Plastic Sequins</image:title>
      <image:caption>ferozi-color-ring-shape-plastic-sequins</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/purple-color-square-shape-plastic-sequins-sitara-sippi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-28-12-45-7_product_1_1651130107215.jpg?v=1651130113</image:loc>
      <image:title>Purple Square Plastic Sequins/ Sitara/Sippi</image:title>
      <image:caption>purple-color-square-shape-plastic-sequins-sitara-sippi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-goldden-color-round-shape-plastic-sequins-sitara-sippi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-28-12-47-26_product_1_1651130246907.jpg?v=1651130253</image:loc>
      <image:title>Light Goldden Round Plastic Sequins/ Sitara/Sippi</image:title>
      <image:caption>light-goldden-color-round-shape-plastic-sequins-sitara-sippi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-green-color-ring-shape-plastic-sequins-sitara-sippi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-28-12-50-4_product_1_1651130404495.jpg?v=1651130411</image:loc>
      <image:title>Light Green Ring Plastic Sequins/ Sitara/Sippi</image:title>
      <image:caption>light-green-color-ring-shape-plastic-sequins-sitara-sippi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dull-golden-color-round-shape-plastic-sequins-sitara-sippi-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-28-12-52-56_product_1_1651130576965.jpg?v=1651130582</image:loc>
      <image:title>Dull Golden Round Plastic Sequins/ Sitara/Sippi</image:title>
      <image:caption>dull-golden-color-round-shape-plastic-sequins-sitara-sippi-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-color-leaf-shape-plastic-sequins-sitara-sippi-seq0080</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-28-12-59-39_product_1_1651130979582.jpg?v=1651130985</image:loc>
      <image:title>Peach Leaf Plastic Sequins/Sitara/Sippi</image:title>
      <image:caption>peach-color-leaf-shape-plastic-sequins-sitara-sippi-seq0080</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-76</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-29-14-31-8_product_1_1651222868564.jpg?v=1651222875</image:loc>
      <image:title>White Fancy Czech Glass Beads</image:title>
      <image:caption>fancy-glass-beads-76</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-128</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-29-15-32-44_product_1_1651226564774.jpg?v=1651226575</image:loc>
      <image:title>White Bicone Fancy Czech Glass Beads</image:title>
      <image:caption>fancy-glass-beads-128</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-129</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-29-15-35-44_product_1_1651226744469.jpg?v=1651226750</image:loc>
      <image:title>Yellow Flat Circular Fancy Czech Glass Beads</image:title>
      <image:caption>fancy-glass-beads-129</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-130</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-29-15-39-28_product_1_1651226968424.jpg?v=1651226974</image:loc>
      <image:title>Yellow Circular Fancy Czech Glass Beads- 6 mm</image:title>
      <image:caption>fancy-glass-beads-130</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-131</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-29-15-43-24_product_1_1651227204205.jpg?v=1651227211</image:loc>
      <image:title>Yellow Cylindrical Fancy Czech Glass Beads- 6x9 mm</image:title>
      <image:caption>fancy-glass-beads-131</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-132</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-29-15-47-2_product_1_1651227422710.jpg?v=1651227430</image:loc>
      <image:title>Yellow Flat Circular Fancy Czech Glass Beads- 6x8 mm</image:title>
      <image:caption>fancy-glass-beads-132</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-133</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-29-16-13-37_product_1_1651229017851.jpg?v=1651229026</image:loc>
      <image:title>Yellow Oval Fancy Czech Glass Beads- 6x8 mm</image:title>
      <image:caption>fancy-glass-beads-133</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-134</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-29-16-17-6_product_1_1651229226134.jpg?v=1651229231</image:loc>
      <image:title>Yellow Bicone Fancy Czech Glass Beads- 7x8 mm</image:title>
      <image:caption>fancy-glass-beads-134</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-135</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-29-16-27-14_product_1_1651229834135.jpg?v=1651229842</image:loc>
      <image:title>Gray Bicone Fancy Czech Glass Beads- 8x8 mm</image:title>
      <image:caption>fancy-glass-beads-135</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-136</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-29-16-30-23_product_1_1651230023460.jpg?v=1651230029</image:loc>
      <image:title>Pink Oval Fancy Czech Glass Beads- 6x10 mm</image:title>
      <image:caption>fancy-glass-beads-136</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-139</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-30-10-23-6_product_1_1651294386292.jpg?v=1651294391</image:loc>
      <image:title>Pink Bicone Fancy Czech Glass Beads- 8x8 mm</image:title>
      <image:caption>fancy-glass-beads-139</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-140</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-30-10-25-31_product_1_1651294531970.jpg?v=1651294547</image:loc>
      <image:title>Light Yellow Circular Fancy Czech Glass Beads- 4 mm</image:title>
      <image:caption>fancy-glass-beads-140</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-141</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-30-10-32-21_product_1_1651294941925.jpg?v=1651294948</image:loc>
      <image:title>Blue Fancy Czech Glass Beads- 8 mm</image:title>
      <image:caption>fancy-glass-beads-141</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-142</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-30-10-44-19_product_1_1651295659870.jpg?v=1651295666</image:loc>
      <image:title>Black Oval Fancy Czech Glass Beads- 6x10 mm</image:title>
      <image:caption>fancy-glass-beads-142</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-143</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-30-10-46-52_product_1_1651295812436.jpg?v=1651295818</image:loc>
      <image:title>Maroon Bicone Fancy Czech Glass Beads- 8x8 mm</image:title>
      <image:caption>fancy-glass-beads-143</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-144</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-30-10-52-6_product_1_1651296126381.jpg?v=1651296131</image:loc>
      <image:title>Lavender Bicone Fancy Czech Glass Beads- 8x8 mm</image:title>
      <image:caption>fancy-glass-beads-144</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-145</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-30-11-14-53_product_1_1651297493524.jpg?v=1651297500</image:loc>
      <image:title>Olive Green Flat Circular Fancy Czech Glass Beads- 8x11 mm</image:title>
      <image:caption>fancy-glass-beads-145</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-146</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-30-11-20-46_product_1_1651297846228.jpg?v=1651297852</image:loc>
      <image:title>Dark Green Flat Circular Fancy Czech Glass Beads- 6x8 mm</image:title>
      <image:caption>fancy-glass-beads-146</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-147</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-30-11-23-1_product_1_1651297981548.jpg?v=1651297989</image:loc>
      <image:title>Dark Blue Circular Fancy Czech Glass Beads- 6 mm</image:title>
      <image:caption>fancy-glass-beads-147</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-149</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-30-11-51-6_product_1_1651299666380.jpg?v=1651299671</image:loc>
      <image:title>Light Brown Cuboidal Fancy Czech Glass Beads- 6x6 mm</image:title>
      <image:caption>fancy-glass-beads-149</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-150</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-30-11-54-11_product_1_1651299851359.jpg?v=1651299857</image:loc>
      <image:title>Light Brown Drop Fancy Czech Glass Beads- 6x8 mm</image:title>
      <image:caption>fancy-glass-beads-150</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-bead-6</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-30-11-56-37_product_1_1651299997027.jpg?v=1651300001</image:loc>
      <image:title>Dark Gray Oval Fancy Czech Glass Bead- 6x8 mm</image:title>
      <image:caption>fancy-glass-bead-6</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-151</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-30-11-59-7_product_1_1651300147859.jpg?v=1651300153</image:loc>
      <image:title>Blue Gray Bicone Fancy Czech Glass Beads- 8x8 mm</image:title>
      <image:caption>fancy-glass-beads-151</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-152</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-30-12-4-16_product_1_1651300456611.jpg?v=1651300461</image:loc>
      <image:title>Light Gray Flat Circular Fancy Czech Glass Beads- 6x8 mm</image:title>
      <image:caption>fancy-glass-beads-152</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-153</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-30-12-8-6_product_1_1651300686521.jpg?v=1651300693</image:loc>
      <image:title>Purple Bicone Fancy Czech Glass Beads- 6x8 mm</image:title>
      <image:caption>fancy-glass-beads-153</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-154</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-30-12-27-8_product_1_1651301828099.jpg?v=1651301833</image:loc>
      <image:title>Light Brown Cuboidal Fancy Czech Glass Beads- 6x6 mm</image:title>
      <image:caption>fancy-glass-beads-154</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-157</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-30-12-34-41_product_1_1651302281975.jpg?v=1651302289</image:loc>
      <image:title>Light Blue Cylindrical Fancy Czech Glass Beads- 6x9 mm</image:title>
      <image:caption>fancy-glass-beads-157</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-158</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-30-12-39-16_product_1_1651302556939.jpg?v=1651302561</image:loc>
      <image:title>Light Brown Bicone Fancy Czech Glass Beads- 6x10 mm</image:title>
      <image:caption>fancy-glass-beads-158</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-159</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-30-12-41-41_product_1_1651302701203.jpg?v=1651302707</image:loc>
      <image:title>Light Brown Bicone Fancy Czech Glass Beads- 8x8 mm</image:title>
      <image:caption>fancy-glass-beads-159</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-glass-beads-160</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-30-12-43-45_product_1_1651302825994.jpg?v=1651302834</image:loc>
      <image:title>Light Brown Cuboidal Fancy Czech Glass Beads- 5x7 mm</image:title>
      <image:caption>fancy-glass-beads-160</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-plain-dyed-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-4-30-16-7-21_product_1_1651315041291.jpg?v=1651315054</image:loc>
      <image:title>Blue Plain Dyed Cotton Fabric</image:title>
      <image:caption>blue-plain-dyed-cotton-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/aqua-blue-new-cut-glass-beads-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-19-46-6_product_1_1651587366214.jpg?v=1651587376</image:loc>
      <image:title>Aqua Blue New Cut Glass Crystal Beads</image:title>
      <image:caption>aqua-blue-new-cut-glass-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-new-cut-glass-beads-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-19-53-50_product_1_1651587830832.jpg?v=1651587839</image:loc>
      <image:title>Green New Cut Glass Crystal Beads</image:title>
      <image:caption>green-new-cut-glass-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-green-new-cut-glass-beads-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-19-56-2_product_1_1651587962854.jpg?v=1651587970</image:loc>
      <image:title>Dark Green New Cut Glass Crystal Beads</image:title>
      <image:caption>dark-green-new-cut-glass-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/baby-pink-new-cut-glass-beads-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-19-59-13_product_1_1651588153484.jpg?v=1651588165</image:loc>
      <image:title>Baby Pink New Cut Glass Crystal Beads</image:title>
      <image:caption>baby-pink-new-cut-glass-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-new-cut-glass-beads-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-20-1-46_product_1_1651588306789.jpg?v=1651588315</image:loc>
      <image:title>Yellow New Cut Glass Crystal Beads</image:title>
      <image:caption>yellow-new-cut-glass-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-new-cut-glass-beads-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-20-4-4_product_1_1651588444184.jpg?v=1651588452</image:loc>
      <image:title>Red New Cut Glass Crystal Beads</image:title>
      <image:caption>red-new-cut-glass-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-new-cut-glass-beads-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-20-6-30_product_1_1651588590153.jpg?v=1651588598</image:loc>
      <image:title>Black New Cut Glass Crystal Beads</image:title>
      <image:caption>black-new-cut-glass-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/jet-black-drop-glass-beads-with-catcher-30x20mm-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-20-15-44_product_1_1651589144670.jpg?v=1651589153</image:loc>
      <image:title>Jet Black Drop Glass Stones With Catcher- 30x20mm</image:title>
      <image:caption>jet-black-drop-glass-beads-with-catcher-30x20mm-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/topaz-brown-drop-glass-beads-with-catcher-30x20mm-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-20-37-17_product_1_1651590437502.jpg?v=1651590447</image:loc>
      <image:title>Topaz Brown Drop Glass Stones With Catcher- 30x20mm</image:title>
      <image:caption>topaz-brown-drop-glass-beads-with-catcher-30x20mm-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-grey-drop-glass-beads-with-catcher-30x20mm-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-20-39-4_product_1_1651590544525.jpg?v=1651590554</image:loc>
      <image:title>Dark Gray Drop Glass Stones With Catcher- 30x20mm</image:title>
      <image:caption>dark-grey-drop-glass-beads-with-catcher-30x20mm-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-drop-glass-beads-with-catcher-30x20mm-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-20-41-9_product_1_1651590669225.jpg?v=1651590676</image:loc>
      <image:title>Red Drop Glass Stones With Catcher- 30x20mm</image:title>
      <image:caption>red-drop-glass-beads-with-catcher-30x20mm-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ink-blue-oval-glass-beads-with-golden-catcher-30x20mm-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-21-3-23_product_1_1651592003432.jpg?v=1651592011</image:loc>
      <image:title>Ink Blue Oval Glass Stones With Golden Catcher- 30x20mm</image:title>
      <image:caption>ink-blue-oval-glass-beads-with-golden-catcher-30x20mm-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/topaz-golden-oval-glass-beads-with-golden-catcher-30x20mm-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-21-5-29_product_1_1651592129062.jpg?v=1651592137</image:loc>
      <image:title>Topaz Golden Oval Glass Stones With Golden Catcher- 30x20mm</image:title>
      <image:caption>topaz-golden-oval-glass-beads-with-golden-catcher-30x20mm-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/lct-golden-rectangular-glass-beads-with-catcher-18x13mm-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-22-2-49_product_1_1651595569142.jpg?v=1651595576</image:loc>
      <image:title>LCT Golden Rectangular Glass Stones With Catcher- 18x13mm</image:title>
      <image:caption>lct-golden-rectangular-glass-beads-with-catcher-18x13mm-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-golden-circular-plastic-stone-without-hole-8-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-22-11-28_product_1_1651596088411.jpg?v=1651596099</image:loc>
      <image:title>Dark Golden Circular Plastic Stone Without Hole- 8 mm</image:title>
      <image:caption>dark-golden-circular-plastic-stone-without-hole-8-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-golden-oval-plastic-stone-without-hole-8x6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-22-14-37_product_1_1651596277447.jpg?v=1651596286</image:loc>
      <image:title>Dark Golden Oval Plastic Stone Without Hole- 8x6 mm</image:title>
      <image:caption>dark-golden-oval-plastic-stone-without-hole-8x6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-pentagon-plastic-stone-without-hole-10x13-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-22-16-44_product_1_1651596404315.jpg?v=1651596413</image:loc>
      <image:title>Golden Pentagonal Plastic Stone Without Hole- 10x13 mm</image:title>
      <image:caption>golden-pentagon-plastic-stone-without-hole-10x13-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-leaf-plastic-stone-without-hole-3x18-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-22-20-58_product_1_1651596658434.jpg?v=1651596666</image:loc>
      <image:title>Golden Leaf Plastic Stone Without Hole- 3x18 mm</image:title>
      <image:caption>golden-leaf-plastic-stone-without-hole-3x18-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-eye-plastic-stone-without-hole-9x15-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-22-22-56_product_1_1651596776328.jpg?v=1651596784</image:loc>
      <image:title>Golden Eye Plastic Stone Without Hole- 9x15 mm</image:title>
      <image:caption>golden-eye-plastic-stone-without-hole-9x15-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-uneven-plastic-stone-without-hole-12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-22-24-24_product_1_1651596864760.jpg?v=1651596873</image:loc>
      <image:title>Golden Uneven Plastic Stone Without Hole- 12 mm</image:title>
      <image:caption>golden-uneven-plastic-stone-without-hole-12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-rectangular-plastic-stone-without-hole-6x18-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-22-26-51_product_1_1651597011950.jpg?v=1651597020</image:loc>
      <image:title>Golden Rectangular Plastic Stone Without Hole- 6x18 mm</image:title>
      <image:caption>golden-rectangular-plastic-stone-without-hole-6x18-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-rectangular-plastic-stone-without-hole-7x26-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-22-28-52_product_1_1651597132458.jpg?v=1651597142</image:loc>
      <image:title>Golden Rectangular Plastic Stone Without Hole- 7x26 mm</image:title>
      <image:caption>golden-rectangular-plastic-stone-without-hole-7x26-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-rectangular-plastic-stone-without-hole-12x20-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-22-41-39_product_1_1651597899732.jpg?v=1651597906</image:loc>
      <image:title>Golden Rectangular Plastic Stone Without Hole- 12x20 mm</image:title>
      <image:caption>golden-rectangular-plastic-stone-without-hole-12x20-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-square-plastic-stone-without-hole-14x14-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-22-43-33_product_1_1651598013913.jpg?v=1651598022</image:loc>
      <image:title>Golden Square Plastic Stone Without Hole- 14x14 mm</image:title>
      <image:caption>golden-square-plastic-stone-without-hole-14x14-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-uneven-plastic-stone-without-hole-9x27-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-22-45-39_product_1_1651598139691.jpg?v=1651598150</image:loc>
      <image:title>Golden Uneven Plastic Stone Without Hole- 9x27 mm</image:title>
      <image:caption>golden-uneven-plastic-stone-without-hole-9x27-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-uneven-plastic-stone-without-hole-12x25-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-22-47-27_product_1_1651598247427.jpg?v=1651598255</image:loc>
      <image:title>Golden Uneven Plastic Stone Without Hole- 12x25 mm</image:title>
      <image:caption>golden-uneven-plastic-stone-without-hole-12x25-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-diamond-plastic-stone-without-hole-24x13-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-22-51-1_product_1_1651598461031.jpg?v=1651598471</image:loc>
      <image:title>Golden Diamond Plastic Stone Without Hole- 24x13 mm</image:title>
      <image:caption>golden-diamond-plastic-stone-without-hole-24x13-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-eye-plastic-stone-without-hole-27x21-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-22-53-6_product_1_1651598586650.jpg?v=1651598594</image:loc>
      <image:title>Golden Eye Plastic Stone Without Hole- 27x21 mm</image:title>
      <image:caption>golden-eye-plastic-stone-without-hole-27x21-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-designer-plastic-stone-without-hole-25x18-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-22-55-4_product_1_1651598704459.jpg?v=1651598715</image:loc>
      <image:title>Golden Designer Plastic Stone Without Hole- 25x18 mm</image:title>
      <image:caption>golden-designer-plastic-stone-without-hole-25x18-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-rectangular-plastic-stone-without-hole-35x12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-22-57-15_product_1_1651598835844.jpg?v=1651598843</image:loc>
      <image:title>Golden Rectangular Plastic Stone Without Hole- 35x12 mm</image:title>
      <image:caption>golden-rectangular-plastic-stone-without-hole-35x12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-rectangular-plastic-stone-without-hole-18x16-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-22-59-41_product_1_1651598981595.jpg?v=1651598991</image:loc>
      <image:title>Golden Rectangular Plastic Stone Without Hole- 18x16 mm</image:title>
      <image:caption>golden-rectangular-plastic-stone-without-hole-18x16-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-designer-plastic-stone-without-hole-21x27-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-3-23-1-33_product_1_1651599093156.jpg?v=1651599103</image:loc>
      <image:title>Golden Designer Plastic Stone Without Hole- 21x27 mm</image:title>
      <image:caption>golden-designer-plastic-stone-without-hole-21x27-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cream-hexagonal-plastic-stone-without-hole-2-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-5-13-10-2_product_1_1651736402038.jpg?v=1651736409</image:loc>
      <image:title>Cream Hexagonal Plastic Stone Without Hole- 2 mm</image:title>
      <image:caption>cream-hexagonal-plastic-stone-without-hole-2-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-yellow-eye-plastic-stone-without-hole-6x12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-5-13-15-27_product_1_1651736727745.jpg?v=1651736733</image:loc>
      <image:title>Light Yellow Eye Plastic Stone Without Hole- 6x12 mm</image:title>
      <image:caption>light-yellow-eye-plastic-stone-without-hole-6x12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-yellow-oval-plastic-stone-without-hole-20x6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-5-13-17-51_product_1_1651736871828.jpg?v=1651736878</image:loc>
      <image:title>Light Yellow Oval Plastic Stone Without Hole- 20x6 mm</image:title>
      <image:caption>light-yellow-oval-plastic-stone-without-hole-20x6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cream-eye-plastic-stone-with-catcher-15x7-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-5-13-20-58_product_1_1651737058581.jpg?v=1651737065</image:loc>
      <image:title>Cream Eye Plastic Stone With Catcher- 15x7 mm</image:title>
      <image:caption>cream-eye-plastic-stone-with-catcher-15x7-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-assorted-2-hole-plastic-stone</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-5-13-32-5_product_1_1651737725434.jpg?v=1651737732</image:loc>
      <image:title>Multicolor Assorted 2 Hole Plastic Stone</image:title>
      <image:caption>multicolor-assorted-2-hole-plastic-stone</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-designer-oval-plastic-stone-without-hole-30x20-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-5-13-36-40_product_1_1651738000202.jpg?v=1651738007</image:loc>
      <image:title>Black Designer Oval Plastic Stone Without Hole- 30x20 mm</image:title>
      <image:caption>black-designer-oval-plastic-stone-without-hole-30x20-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-oval-plastic-stone-without-hole-30x40-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-5-13-43-47_product_1_1651738427004.jpg?v=1651738433</image:loc>
      <image:title>Green Oval Plastic Stone Without Hole- 30x40 mm</image:title>
      <image:caption>green-oval-plastic-stone-without-hole-30x40-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-plain-polyester-dola-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-5-14-27-27_product_1_1651741047381.jpg?v=1755926185</image:loc>
      <image:title>Peach Orange Plain Dola Silk Fabric</image:title>
      <image:caption>peach-plain-polyester-dola-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dusk-blue-plain-bangalore-raw-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-5-15-1-46_product_1_1651743106072.jpg?v=1756272938</image:loc>
      <image:title>Dusk Blue Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>dusk-blue-plain-bangalore-raw-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/gun-metal-grey-triangular-plastic-stud-beads-6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-5-19-21-2_product_1_1651758662673.jpg?v=1651758670</image:loc>
      <image:title>Gun Metal Gray Triangular Plastic Stud Beads- 6 mm</image:title>
      <image:caption>gun-metal-grey-triangular-plastic-stud-beads-6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/gun-metal-grey-flat-triangular-plastic-stud-beads-8-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-5-19-44-50_product_1_1651760090548.jpg?v=1651760098</image:loc>
      <image:title>Gun Metal Gray Flat Triangular Plastic Stud Beads- 8 mm</image:title>
      <image:caption>gun-metal-grey-flat-triangular-plastic-stud-beads-8-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/gun-metal-grey-flat-triangular-plastic-stud-beads-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-5-19-46-26_product_1_1651760186396.jpg?v=1651760194</image:loc>
      <image:title>Gun Metal Gray Flat Triangular Plastic Stud Beads- 10 mm</image:title>
      <image:caption>gun-metal-grey-flat-triangular-plastic-stud-beads-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/gun-metal-grey-flat-triangular-plastic-stud-beads-12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-5-19-50-36_product_1_1651760436081.jpg?v=1651760443</image:loc>
      <image:title>Gun Metal Gray Flat Triangular Plastic Stud Beads- 12 mm</image:title>
      <image:caption>gun-metal-grey-flat-triangular-plastic-stud-beads-12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/gun-metal-grey-pyramid-plastic-stud-beads-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-5-19-56-49_product_1_1651760809390.jpg?v=1651760818</image:loc>
      <image:title>Gun Metal Gray Pyramid Plastic Stud Beads- 10 mm</image:title>
      <image:caption>gun-metal-grey-pyramid-plastic-stud-beads-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/nickel-silver-flat-triangular-plastic-stud-beads-6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-5-20-2-3_product_1_1651761123922.jpg?v=1651761131</image:loc>
      <image:title>Nickel Silver Flat Triangular Plastic Stud Beads- 6 mm</image:title>
      <image:caption>nickel-silver-flat-triangular-plastic-stud-beads-6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/nickel-silver-flat-triangular-plastic-stud-beads-8-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-5-20-4-3_product_1_1651761243685.jpg?v=1651761251</image:loc>
      <image:title>Nickel Silver Flat Triangular Plastic Stud Beads- 8 mm</image:title>
      <image:caption>nickel-silver-flat-triangular-plastic-stud-beads-8-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/nickel-silver-triangular-plastic-stud-beads-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-5-20-5-42_product_1_1651761342839.jpg?v=1651761350</image:loc>
      <image:title>Nickel Silver Triangular Plastic Stud Beads- 10 mm</image:title>
      <image:caption>nickel-silver-triangular-plastic-stud-beads-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/nickel-silver-flat-triangular-plastic-stud-beads-12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-5-20-7-59_product_1_1651761479121.jpg?v=1651761486</image:loc>
      <image:title>Nickel Silver Flat Triangular Plastic Stud Beads- 12 mm</image:title>
      <image:caption>nickel-silver-flat-triangular-plastic-stud-beads-12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-rainbow-drop-plastic-loreal-beads-10x21-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-6-13-32-11_product_1_1651824131309.jpg?v=1651824137</image:loc>
      <image:title>Green Drop Plastic Loreal Beads- 10x21 mm</image:title>
      <image:caption>green-rainbow-drop-plastic-loreal-beads-10x21-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-pink-rainbow-drop-plastic-loreal-beads-10x21-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-6-13-33-37_product_1_1651824217010.jpg?v=1651824223</image:loc>
      <image:title>Light Pink Drop Plastic Loreal Beads- 10x21 mm</image:title>
      <image:caption>light-pink-rainbow-drop-plastic-loreal-beads-10x21-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-drop-plastic-loreal-beads-18x7-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-6-13-41-6_product_1_1651824666475.jpg?v=1651824672</image:loc>
      <image:title>Golden Drop Plastic Loreal Beads- 18x7 mm</image:title>
      <image:caption>golden-drop-plastic-loreal-beads-18x7-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-drop-plastic-loreal-beads-18x7-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-6-13-42-40_product_1_1651824760465.jpg?v=1651824769</image:loc>
      <image:title>Silver Drop Plastic Loreal Beads- 18x7 mm</image:title>
      <image:caption>silver-drop-plastic-loreal-beads-18x7-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-drop-plastic-loreal-beads-27x12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-6-13-44-31_product_1_1651824871626.jpg?v=1651824881</image:loc>
      <image:title>Blue Drop Plastic Loreal Beads- 27x12 mm</image:title>
      <image:caption>blue-drop-plastic-loreal-beads-27x12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-blue-drop-plastic-loreal-beads-27x12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-6-13-46-20_product_1_1651824980627.jpg?v=1651824990</image:loc>
      <image:title>Dark Blue Drop Plastic Loreal Beads- 27x12 mm</image:title>
      <image:caption>dark-blue-drop-plastic-loreal-beads-27x12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/onion-pink-plain-japan-satin-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-6-15-15-56_product_1_1651830356095.jpg?v=1651830365</image:loc>
      <image:title>Onion Pink Plain Japan Satin Fabric</image:title>
      <image:caption>onion-pink-plain-japan-satin-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-golden-designer-drop-plastic-loreal-beads-29x14-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-6-16-37-17_product_1_1651835237301.jpg?v=1651835245</image:loc>
      <image:title>Green Golden Designer Drop Plastic Loreal Beads- 29x14 mm</image:title>
      <image:caption>green-golden-designer-drop-plastic-loreal-beads-29x14-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/beige-designer-drop-plastic-loreal-beads-29x14-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-6-16-40-3_product_1_1651835403904.jpg?v=1651835412</image:loc>
      <image:title>Beige Designer Drop Plastic Loreal Beads- 29x14 mm</image:title>
      <image:caption>beige-designer-drop-plastic-loreal-beads-29x14-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-golden-designer-drop-plastic-loreal-beads-29x14-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-6-16-42-28_product_1_1651835548734.jpg?v=1651835556</image:loc>
      <image:title>Red Golden Designer Drop Plastic Loreal Beads- 29x14 mm</image:title>
      <image:caption>red-golden-designer-drop-plastic-loreal-beads-29x14-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/off-white-golden-designer-drop-plastic-loreal-beads-29x14-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-6-16-44-15_product_1_1651835655023.jpg?v=1651835666</image:loc>
      <image:title>Off White Golden Designer Drop Plastic Loreal Beads- 29x14 mm</image:title>
      <image:caption>off-white-golden-designer-drop-plastic-loreal-beads-29x14-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-golden-designer-drop-plastic-loreal-beads-29x14-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-6-16-46-0_product_1_1651835760574.jpg?v=1651835771</image:loc>
      <image:title>Pink Golden Designer Drop Plastic Loreal Beads- 29x14 mm</image:title>
      <image:caption>pink-golden-designer-drop-plastic-loreal-beads-29x14-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-blue-designer-drop-plastic-loreal-beads-12x22-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-6-16-48-18_product_1_1651835898331.jpg?v=1651835906</image:loc>
      <image:title>Light Blue Designer Drop Plastic Loreal Beads- 12x22 mm</image:title>
      <image:caption>light-blue-designer-drop-plastic-loreal-beads-12x22-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/orange-designer-drop-plastic-loreal-beads-30x12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-6-16-49-51_product_1_1651835991583.jpg?v=1651836000</image:loc>
      <image:title>Orange Designer Drop Plastic Loreal Beads- 30x12 mm</image:title>
      <image:caption>orange-designer-drop-plastic-loreal-beads-30x12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-drop-plastic-beads-without-hole-4x6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-6-17-21-16_product_1_1651837876473.jpg?v=1651837888</image:loc>
      <image:title>White Drop Plastic Beads Without Hole- 4x6 mm</image:title>
      <image:caption>white-drop-plastic-beads-without-hole-4x6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-circular-plastic-beads-without-hole-4-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-6-17-22-40_product_1_1651837960137.jpg?v=1651837968</image:loc>
      <image:title>White Circular Plastic Beads Without Hole- 4 mm</image:title>
      <image:caption>white-circular-plastic-beads-without-hole-4-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/of-white-eye-plastic-beads-without-hole-6x12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-6-17-24-25_product_1_1651838065260.jpg?v=1651838076</image:loc>
      <image:title>Off White Eye Plastic Beads Without Hole- 6x12 mm</image:title>
      <image:caption>of-white-eye-plastic-beads-without-hole-6x12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-oval-plastic-beads-without-hole-4x6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-6-17-26-49_product_1_1651838209788.jpg?v=1651838217</image:loc>
      <image:title>White Oval Plastic Beads Without Hole- 4x6 mm</image:title>
      <image:caption>white-oval-plastic-beads-without-hole-4x6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-plain-bangalore-raw-silk-fabric-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-9-12-42-14_product_1_1652080334114.jpg?v=1761715266</image:loc>
      <image:title>Black Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>black-plain-bangalore-raw-silk-fabric-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-plain-bangalore-raw-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1_new.jpg?v=1763117901</image:loc>
      <image:title>Golden Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>golden-plain-bangalore-raw-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/persian-red-plain-bangalore-raw-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-9-13-8-51_product_1_1652081931507.jpg?v=1756272931</image:loc>
      <image:title>Persian Red Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>persian-red-plain-bangalore-raw-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/timber-green-plain-bangalore-raw-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/img_9717.jpg?v=1761980626</image:loc>
      <image:title>Green Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>timber-green-plain-bangalore-raw-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-circular-glass-beads-hanging-8-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-9-13-25-16_product_1_1652082916217.jpg?v=1652082924</image:loc>
      <image:title>Blue Circular Glass Beads Hanging- 8 mm</image:title>
      <image:caption>blue-circular-glass-beads-hanging-8-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crack-white-circular-glass-beads-hanging-8-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-9-13-29-9_product_1_1652083149164.jpg?v=1652083158</image:loc>
      <image:title>Crack White Circular Glass Loreal Beads- 8 mm</image:title>
      <image:caption>crack-white-circular-glass-beads-hanging-8-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crack-purple-circular-glass-beads-hanging-8-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-9-13-30-33_product_1_1652083233227.jpg?v=1652083242</image:loc>
      <image:title>Crack Purple Circular Glass Loreal Beads- 8 mm</image:title>
      <image:caption>crack-purple-circular-glass-beads-hanging-8-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-sea-green-plain-polyester-dola-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-9-13-32-46_product_1_1652083366959.jpg?v=1652083375</image:loc>
      <image:title>Light Sea Green Plain Dola Silk Fabric</image:title>
      <image:caption>light-sea-green-plain-polyester-dola-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pearl-white-circular-glass-beads-hanging-8-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-9-13-32-47_product_1_1652083367179.jpg?v=1652083377</image:loc>
      <image:title>Pearl White Circular Glass Loreal Beads- 8 mm</image:title>
      <image:caption>pearl-white-circular-glass-beads-hanging-8-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pearl-grey-circular-glass-beads-hanging-8-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-9-13-34-10_product_1_1652083450635.jpg?v=1652083459</image:loc>
      <image:title>Pearl Gray Circular Glass Loreal Beads- 8 mm</image:title>
      <image:caption>pearl-grey-circular-glass-beads-hanging-8-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/milky-opal-white-circular-glass-beads-hanging-8-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-9-13-35-56_product_1_1652083556301.jpg?v=1652083565</image:loc>
      <image:title>Milky Opal White Circular Glass Loreal Beads- 8 mm</image:title>
      <image:caption>milky-opal-white-circular-glass-beads-hanging-8-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/metal-golden-with-stones-circular-glass-beads-hanging-8-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-9-13-37-55_product_1_1652083675146.jpg?v=1652083686</image:loc>
      <image:title>Metal Golden With Stones Circular Glass Loreal Beads- 8 mm</image:title>
      <image:caption>metal-golden-with-stones-circular-glass-beads-hanging-8-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/lct-shadow-golden-circular-glass-beads-hanging-8-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-9-13-39-32_product_1_1652083772608.jpg?v=1652083784</image:loc>
      <image:title>LCT Shadow Golden Circular Glass Loreal Beads- 8 mm</image:title>
      <image:caption>lct-shadow-golden-circular-glass-beads-hanging-8-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/aqua-blue-circular-faceted-glass-beads-hanging-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-9-13-41-14_product_1_1652083874236.jpg?v=1652083884</image:loc>
      <image:title>Aqua Blue Circular Faceted Glass Loreal Beads- 10 mm</image:title>
      <image:caption>aqua-blue-circular-faceted-glass-beads-hanging-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pearl-white-circular-glass-beads-hanging-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-9-13-42-50_product_1_1652083970681.jpg?v=1652083981</image:loc>
      <image:title>Pearl White Circular Glass Loreal Beads- 10 mm</image:title>
      <image:caption>pearl-white-circular-glass-beads-hanging-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/orange-circular-glass-beads-hanging-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-9-13-44-2_product_1_1652084042411.jpg?v=1652084056</image:loc>
      <image:title>Orange Circular Glass Loreal Beads- 10 mm</image:title>
      <image:caption>orange-circular-glass-beads-hanging-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/rose-gold-flower-metal-embellishment-50-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-9-16-57-26_product_1_1652095646329.jpg?v=1652095655</image:loc>
      <image:title>Rose Gold Flower Metal Embellishment-50 mm</image:title>
      <image:caption>rose-gold-flower-metal-embellishment-50-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/rose-gold-designer-flower-metal-embellishment-55-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-9-17-5-40_product_1_1652096140807.jpg?v=1652096152</image:loc>
      <image:title>Rose Gold Designer Flower Metal Embellishment-55 mm</image:title>
      <image:caption>rose-gold-designer-flower-metal-embellishment-55-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-grey-designer-flower-metal-embellishment-50x39-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-9-17-8-3_product_1_1652096283344.jpg?v=1652096291</image:loc>
      <image:title>Golden Gray Designer Flower Metal Embellishment-50x39 mm</image:title>
      <image:caption>golden-grey-designer-flower-metal-embellishment-50x39-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/rose-gold-designer-flower-metal-embellishment-55x48-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-9-17-10-25_product_1_1652096425841.jpg?v=1652096434</image:loc>
      <image:title>Rose Gold Designer Flower Metal Embellishment- 55x48 mm</image:title>
      <image:caption>rose-gold-designer-flower-metal-embellishment-55x48-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-golden-square-metal-embellishment-50x50-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-9-17-12-27_product_1_1652096547032.jpg?v=1652096556</image:loc>
      <image:title>Light Golden Square Metal Embellishment- 50x50 mm</image:title>
      <image:caption>light-golden-square-metal-embellishment-50x50-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-oval-designer-metal-embellishment-52x39-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-9-17-15-59_product_1_1652096759956.jpg?v=1652096768</image:loc>
      <image:title>Golden Oval Designer Metal Embellishment- 52x39 mm</image:title>
      <image:caption>golden-oval-designer-metal-embellishment-52x39-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/matte-golden-bowl-plastic-sequins-3-mm-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Matte_Golden_Bowl_Plastic_Sequins_-_3_mm_product_1_1614324885541_f40252fd-6be1-4e8f-a862-b476ca228487.jpg?v=1652101806</image:loc>
      <image:title>Matte Golden Bowl Plastic Sequins - 3 mm</image:title>
      <image:caption>matte-golden-bowl-plastic-sequins-3-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-silver-circular-glass-loreal-beads-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-10-13-9-19_product_1_1652168359707.jpg?v=1652168365</image:loc>
      <image:title>Green Silver Circular Glass Loreal Beads- 10 mm</image:title>
      <image:caption>green-silver-circular-glass-loreal-beads-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/magenta-silver-circular-glass-loreal-beads-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-10-13-11-3_product_1_1652168463895.jpg?v=1652168471</image:loc>
      <image:title>Magenta Silver Circular Glass Loreal Beads- 10 mm</image:title>
      <image:caption>magenta-silver-circular-glass-loreal-beads-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-blue-silver-circular-glass-loreal-beads-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-10-13-12-44_product_1_1652168564604.jpg?v=1652168572</image:loc>
      <image:title>Light Blue Silver Circular Glass Loreal Beads- 10 mm</image:title>
      <image:caption>light-blue-silver-circular-glass-loreal-beads-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/purple-silver-circular-glass-loreal-beads-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-10-13-17-11_product_1_1652168831452.jpg?v=1652168838</image:loc>
      <image:title>Purple Silver Circular Glass Loreal Beads- 10 mm</image:title>
      <image:caption>purple-silver-circular-glass-loreal-beads-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-multicolor-circular-glass-loreal-beads-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-10-13-18-39_product_1_1652168919987.jpg?v=1652168927</image:loc>
      <image:title>Black Multicolor Circular Glass Loreal Beads- 10 mm</image:title>
      <image:caption>black-multicolor-circular-glass-loreal-beads-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-circular-glass-loreal-beads-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-10-13-20-18_product_1_1652169018847.jpg?v=1652169026</image:loc>
      <image:title>Pink Circular Glass Loreal Beads- 10 mm</image:title>
      <image:caption>pink-circular-glass-loreal-beads-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-blue-circular-glass-loreal-beads-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-10-13-22-34_product_1_1652169154163.jpg?v=1652169161</image:loc>
      <image:title>Light Blue Circular Glass Loreal Beads- 10 mm</image:title>
      <image:caption>light-blue-circular-glass-loreal-beads-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-circular-glass-loreal-beads-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-10-13-26-2_product_1_1652169362985.jpg?v=1652169370</image:loc>
      <image:title>Blue Circular Glass Loreal Beads- 10 mm</image:title>
      <image:caption>blue-circular-glass-loreal-beads-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-flower-metal-embellishment-with-iron-base</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-10-13-31-9_product_1_1652169669339.jpg?v=1652169676</image:loc>
      <image:title>Golden Flower Metal Embellishment With Iron Base</image:title>
      <image:caption>golden-flower-metal-embellishment-with-iron-base</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-designer-flower-metal-embellishment-with-iron-base</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-10-13-33-2_product_1_1652169782127.jpg?v=1652169788</image:loc>
      <image:title>Golden Designer Flower Metal Embellishment With Iron Base</image:title>
      <image:caption>golden-designer-flower-metal-embellishment-with-iron-base</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-floral-square-metal-embellishment-with-iron-base</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-10-13-35-45_product_1_1652169945658.jpg?v=1652169951</image:loc>
      <image:title>Golden Floral Square Metal Embellishment With Iron Base</image:title>
      <image:caption>golden-floral-square-metal-embellishment-with-iron-base</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-red-flower-metal-embellishment-with-iron-base</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-10-13-40-43_product_1_1652170243710.jpg?v=1652510266</image:loc>
      <image:title>Golden Red Flower Metal Embellishment With Iron Base</image:title>
      <image:caption>golden-red-flower-metal-embellishment-with-iron-base</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-stone-studded-eye-metal-embellishment-with-iron-base</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-10-13-50-22_product_1_1652170822293.jpg?v=1652170829</image:loc>
      <image:title>Green Stone Studded Eye Metal Embellishment With Iron Base</image:title>
      <image:caption>green-stone-studded-eye-metal-embellishment-with-iron-base</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-stone-studded-eye-metal-embellishment-with-iron-base</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-10-13-51-45_product_1_1652170905917.jpg?v=1652170911</image:loc>
      <image:title>Pink Stone Studded Eye Metal Embellishment With Iron Base</image:title>
      <image:caption>pink-stone-studded-eye-metal-embellishment-with-iron-base</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-golden-oval-stone-studded-metal-embellishment-with-iron-base</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-10-16-34-32_product_1_1652180672455.jpg?v=1652510899</image:loc>
      <image:title>Blue Golden Oval Stone Studded Metal Embellishment With Iron Base</image:title>
      <image:caption>blue-golden-oval-stone-studded-metal-embellishment-with-iron-base</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-red-oval-stone-studded-metal-embellishment-with-iron-base</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-10-16-36-55_product_1_1652180815874.jpg?v=1652180824</image:loc>
      <image:title>Dark Red Oval Stone Studded Metal Embellishment With Iron Base</image:title>
      <image:caption>dark-red-oval-stone-studded-metal-embellishment-with-iron-base</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-oval-stone-studded-metal-embellishment-with-iron-base</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-10-16-41-13_product_1_1652181073464.jpg?v=1652181081</image:loc>
      <image:title>Green Oval Stone Studded Metal Embellishment With Iron Base</image:title>
      <image:caption>green-oval-stone-studded-metal-embellishment-with-iron-base</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-golden-drop-stone-studded-metal-embellishment-with-iron-base</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-10-16-42-31_product_1_1652181151089.jpg?v=1652181162</image:loc>
      <image:title>Blue Golden Drop Stone Studded Metal Embellishment With Iron Base</image:title>
      <image:caption>blue-golden-drop-stone-studded-metal-embellishment-with-iron-base</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-red-drop-stone-studded-metal-embellishment-with-iron-base</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-10-16-45-29_product_1_1652181329876.jpg?v=1652181339</image:loc>
      <image:title>Dark Red Drop Stone Studded Metal Embellishment With Iron Base</image:title>
      <image:caption>dark-red-drop-stone-studded-metal-embellishment-with-iron-base</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-drop-stone-studded-metal-embellishment-with-iron-base</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-10-16-46-35_product_1_1652181395508.jpg?v=1652181404</image:loc>
      <image:title>Green Drop Stone Studded Metal Embellishment With Iron Base</image:title>
      <image:caption>green-drop-stone-studded-metal-embellishment-with-iron-base</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/assortedhandembroiderystrandedcottonthreadscombopack</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/84f2f1fbad391439fc1ccda2856a1ff1.png?v=1758010721</image:loc>
      <image:title>Multicolour Assorted Hand Embroidery Stranded Cotton Threads  Pack</image:title>
      <image:caption>assortedhandembroiderystrandedcottonthreadscombopack</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/royalbluecolorhandembroiderystrandedcottonthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/4b010e4dcf1b4b68922f1bb764c3c95a.png?v=1652268884</image:loc>
      <image:title>Royal Blue Color Hand Embroidery Stranded Cotton Threads</image:title>
      <image:caption>royalbluecolorhandembroiderystrandedcottonthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/bluecolorhandembroiderystrandedcottonthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/e31bd3a032e5f719c4e3add41884ae78.png?v=1652268898</image:loc>
      <image:title>Blue Color Hand Embroidery Stranded Cotton Threads</image:title>
      <image:caption>bluecolorhandembroiderystrandedcottonthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/purplecolorhandembroiderystrandedcottonthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9f6bcc5d2ef3f5569a3480dc8af34710.png?v=1652268947</image:loc>
      <image:title>Purple Color Hand Embroidery Stranded Cotton Threads</image:title>
      <image:caption>purplecolorhandembroiderystrandedcottonthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/violetcolorhandembroiderystrandedcottonthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/03fc4c5a445c98d23d9f5b5ae4f94a88.png?v=1652268964</image:loc>
      <image:title>Violet Color Hand Embroidery Stranded Cotton Threads</image:title>
      <image:caption>violetcolorhandembroiderystrandedcottonthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/darkpinkcolorhandembroiderystrandedcottonthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/eb9f0cc46575152806f1b94280df7c99.png?v=1652268992</image:loc>
      <image:title>Dark Pink Color Hand Embroidery Stranded Cotton Threads</image:title>
      <image:caption>darkpinkcolorhandembroiderystrandedcottonthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/frenchrosepinkcolorhandembroiderystrandedcottonthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c572da4579e3c11f8cb86a34a95383cc.png?v=1652269005</image:loc>
      <image:title>French Rose Pink Color Hand Embroidery Stranded Cotton Threads</image:title>
      <image:caption>frenchrosepinkcolorhandembroiderystrandedcottonthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pinkpeachcolorhandembroiderystrandedcottonthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9545e123db526befb7174e737eb6a9eb.png?v=1652269019</image:loc>
      <image:title>Pink Peach Color Hand Embroidery Stranded Cotton Threads</image:title>
      <image:caption>pinkpeachcolorhandembroiderystrandedcottonthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pinkcolorhandembroiderystrandedcottonthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c0ed70f80f0bcd7e71682b4580ff87f4.png?v=1652269036</image:loc>
      <image:title>Pink Color Hand Embroidery Stranded Cotton Threads</image:title>
      <image:caption>pinkcolorhandembroiderystrandedcottonthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peachcolorhandembroiderystrandedcottonthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c38bdef1319d90d416e4dd0250d51246.png?v=1652269049</image:loc>
      <image:title>Peach Color Hand Embroidery Stranded Cotton Threads</image:title>
      <image:caption>peachcolorhandembroiderystrandedcottonthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/greenhandembroiderystrandedcottonthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/02157969f138e96d6bcc75df04d34053.png?v=1652269077</image:loc>
      <image:title>Green Hand Embroidery Stranded Cotton Threads</image:title>
      <image:caption>greenhandembroiderystrandedcottonthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/rustypinkyellowshadedhandembroiderystrandedcottonthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/7e59a613d00c6801800140b33eb548bf.png?v=1652269090</image:loc>
      <image:title>Rusty Pink &amp; Yellow Shaded Hand Embroidery Stranded Cotton Threads</image:title>
      <image:caption>rustypinkyellowshadedhandembroiderystrandedcottonthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blueandwhitecolorhandembroiderystrandedcottonthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1422c39889220ba75a68a8b54a820d3a.png?v=1652269104</image:loc>
      <image:title>Blue and White Color Hand Embroidery Stranded Cotton Threads</image:title>
      <image:caption>blueandwhitecolorhandembroiderystrandedcottonthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/darkorangecolorhandembroiderystrandedcottonthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/5359b7c0241da9c0747022bd1e5c4081.png?v=1652274058</image:loc>
      <image:title>Dark Orange Color Hand Embroidery Stranded Cotton Threads</image:title>
      <image:caption>darkorangecolorhandembroiderystrandedcottonthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/redcolorhandembroiderystrandedcottonthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/ff5086450977a5b569a71f9ad638b6e7.png?v=1652274072</image:loc>
      <image:title>Red Color Hand Embroidery Stranded Cotton Threads</image:title>
      <image:caption>redcolorhandembroiderystrandedcottonthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/browncolorhandembroiderystrandedcottonthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/aa96bc9381f326dd4012abd92b8a955d.png?v=1652274085</image:loc>
      <image:title>Brown Color Hand Embroidery Stranded Cotton Threads</image:title>
      <image:caption>browncolorhandembroiderystrandedcottonthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/mustardcolorhandembroiderystrandedcottonthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/13370d9d0edcb6126d1055f3576d43d1.png?v=1652274100</image:loc>
      <image:title>Mustard Color Hand Embroidery Stranded Cotton Threads</image:title>
      <image:caption>mustardcolorhandembroiderystrandedcottonthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellowcolorhandembroiderystrandedcottonthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/8ae1425fdd66b17aeae8343ed6240134.png?v=1652274115</image:loc>
      <image:title>Yellow Color Hand Embroidery Stranded Cotton Threads</image:title>
      <image:caption>yellowcolorhandembroiderystrandedcottonthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/lightbrowncolorhandembroiderystrandedcottonthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/74b5f8d5890a22094fca7c512d7bf258.png?v=1652274131</image:loc>
      <image:title>Light Brown Color Hand Embroidery Stranded Cotton Threads</image:title>
      <image:caption>lightbrowncolorhandembroiderystrandedcottonthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blackcolorhandembroiderystrandedcottonthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/7c0405c2140dda69dfc19aa0c447713d.png?v=1652274145</image:loc>
      <image:title>Black Color Hand Embroidery Stranded Cotton Threads</image:title>
      <image:caption>blackcolorhandembroiderystrandedcottonthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/forestgreencolorhandembroiderystrandedcottonthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/8c5291eb903ed083c5f8745665477326.png?v=1652274175</image:loc>
      <image:title>Forest Green Color Hand Embroidery Stranded Cotton Threads</image:title>
      <image:caption>forestgreencolorhandembroiderystrandedcottonthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/darkgreencolorhandembroiderystrandedcottonthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/0aa5624da2e86617c46f602ea5e652b4.png?v=1652274189</image:loc>
      <image:title>Dark Green Color Hand Embroidery Stranded Cotton Threads</image:title>
      <image:caption>darkgreencolorhandembroiderystrandedcottonthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/darkredcolorhandembroiderystrandedcottonthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/bc243a9fc14b0b6c5653fc953bd78620.png?v=1652274202</image:loc>
      <image:title>Dark Red Color Hand Embroidery Stranded Cotton Threads</image:title>
      <image:caption>darkredcolorhandembroiderystrandedcottonthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/marooncolorhandembroiderystrandedcottonthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/bc243a9fc14b0b6c5653fc953bd78620_e5b39da5-dcbe-453b-aad3-262235f6ff0a.png?v=1652274217</image:loc>
      <image:title>Maroon Color Hand Embroidery Stranded Cotton Threads</image:title>
      <image:caption>marooncolorhandembroiderystrandedcottonthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/seagreencolorhandembroiderystrandedcottonthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9da2e1be2860987446970e47309bd0ab.png?v=1652274232</image:loc>
      <image:title>Sea Green Color Hand Embroidery Stranded Cotton Threads</image:title>
      <image:caption>seagreencolorhandembroiderystrandedcottonthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/olivegreencolorhandembroiderystrandedcottonthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/7c0d9f77adbf0116da3aff57412b65c8.png?v=1652274246</image:loc>
      <image:title>Olive Green Color Hand Embroidery Stranded Cotton Threads</image:title>
      <image:caption>olivegreencolorhandembroiderystrandedcottonthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/lightgreencolorhandembroiderystrandedcottonthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/df1c4358c3905e7f7a6317a749f9e290.png?v=1652274260</image:loc>
      <image:title>Light Green Color Hand Embroidery Stranded Cotton Threads</image:title>
      <image:caption>lightgreencolorhandembroiderystrandedcottonthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/greencolorhandembroiderystrandedcottonthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/bbb49b560d59635a4d8ab3ddf1fc3270.png?v=1652274274</image:loc>
      <image:title>Green Color Hand Embroidery Stranded Cotton Threads</image:title>
      <image:caption>greencolorhandembroiderystrandedcottonthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/coats5shadeshandembroiderystrandedcottonthreads1box</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/800a_3bb06c8c-906e-47ce-8928-f0dfd20144fe.jpg?v=1652274286</image:loc>
      <image:title>Multicolour  5 Shades Hand Embroidery Stranded Cotton Threads-1 Box</image:title>
      <image:caption>coats5shadeshandembroiderystrandedcottonthreads1box</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/coats25shadeshandembroiderystrandedcottonthreads1box</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1_25_25_f03d7d30-8887-456b-a3b2-117c6f6ab32d.jpg?v=1652274302</image:loc>
      <image:title>Multicolour 25 Shades Hand Embroidery Stranded Cotton Threads -1 Box</image:title>
      <image:caption>coats25shadeshandembroiderystrandedcottonthreads1box</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/circularevileyeshellbeads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d817be7cd8b726889ba6381f7ee1a70d.jpg?v=1652359429</image:loc>
      <image:title>Orange Circular Evil Eye Shell beads</image:title>
      <image:caption>circularevileyeshellbeads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ovalevileyeglassbeads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/98f15740bec9ab773605cd95a5e612b3.jpg?v=1652359470</image:loc>
      <image:title>Red Oval Evil Eye Glass Beads</image:title>
      <image:caption>ovalevileyeglassbeads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/whitesuperiorqualitysphericalglasspearls1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/03b5c640047468971a7c5bbf129ab89c.jpg?v=1652359506</image:loc>
      <image:title>White Superior Quality Spherical Glass Pearls</image:title>
      <image:caption>whitesuperiorqualitysphericalglasspearls1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/whitesuperiorqualitysphericalglasspearls2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/ba3db2ec40cd9e3c9fb5478a45c5bded.jpg?v=1652359587</image:loc>
      <image:title>Pearl White Superior Quality Spherical Glass Pearls</image:title>
      <image:caption>whitesuperiorqualitysphericalglasspearls2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/whitesuperiorqualitysphericalglasspearls3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/02b408035fae4a4bdbfb04c9daaf4b47.jpg?v=1652359652</image:loc>
      <image:title>White Superior Quality Drop Glass Pearls</image:title>
      <image:caption>whitesuperiorqualitysphericalglasspearls3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/creamsuperiorqualitysphericalglasspearls</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/3173916ec5d82272d727dcc94871251c.jpg?v=1652359691</image:loc>
      <image:title>Cream Superior Quality Spherical Glass Pearls</image:title>
      <image:caption>creamsuperiorqualitysphericalglasspearls</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/uncutdesignerglassbeads1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/db4db072dab514c52f69e95ea208db55.jpg?v=1652359895</image:loc>
      <image:title>White Black Uncut Designer Glass Beads</image:title>
      <image:caption>uncutdesignerglassbeads1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/uncutdesignerglassbeads2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9ee5ceef61602dfe17eff842442af0b0.jpg?v=1652359923</image:loc>
      <image:title>Dark Purple Uncut Designer Glass Beads</image:title>
      <image:caption>uncutdesignerglassbeads2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/uncutdesignerglassbeads3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/465927cec8dba74fbaca93615ddd666d.jpg?v=1652359951</image:loc>
      <image:title>Light Pink Uncut Designer Glass Beads</image:title>
      <image:caption>uncutdesignerglassbeads3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/uncutdesignerglassbeads4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/b1326a012556961702900c621ba3efc7.jpg?v=1652359977</image:loc>
      <image:title>Blue Uncut Designer Glass Beads</image:title>
      <image:caption>uncutdesignerglassbeads4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/uncutdesignerglassbeads5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cc5b801fcee3f1db6243d79ac4a3ff0c.jpg?v=1652360003</image:loc>
      <image:title>Light Blue Uncut Designer Glass Beads</image:title>
      <image:caption>uncutdesignerglassbeads5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/uncutdesignerglassbeads6</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/f97eed38eede39ffa7f6841d1e1e00cf.jpg?v=1652360028</image:loc>
      <image:title>Off White Uncut Designer Glass Beads</image:title>
      <image:caption>uncutdesignerglassbeads6</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cubicdesignerglassbeads1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6b6b02401b2eec77c3e052af2dec7b81.jpg?v=1652360055</image:loc>
      <image:title>Pink Cubic Designer Glass Beads</image:title>
      <image:caption>cubicdesignerglassbeads1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cubicdesignerglassbeads5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/f5303430ffb2abdea8bb5f674d874986.jpg?v=1652360205</image:loc>
      <image:title>Light Orange Cubic Designer Glass Beads</image:title>
      <image:caption>cubicdesignerglassbeads5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cubicdesignerglassbeads9</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/08e79fef11afc9ccab0108cbab356d5d.jpg?v=1652360358</image:loc>
      <image:title>Blue Pink Cubic Designer Glass Beads</image:title>
      <image:caption>cubicdesignerglassbeads9</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cubicdesignerglassbeads12</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/f0cbdf93d6e429a6bb6a67b1b6382359.jpg?v=1652360447</image:loc>
      <image:title>Yellow Multicolour Cubic Designer Glass Beads</image:title>
      <image:caption>cubicdesignerglassbeads12</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/uncutdesignerglassbeads7</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/57fec225e10da7b969946047474077bf.jpg?v=1652360477</image:loc>
      <image:title>White Uncut Designer Glass Beads</image:title>
      <image:caption>uncutdesignerglassbeads7</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/assortedcrochetsize20cottonthread</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/de309464c4a0c7a601a06a22f3ea260f.png?v=1652442818</image:loc>
      <image:title>Assorted Crochet Cotton Thread</image:title>
      <image:caption>assortedcrochetsize20cottonthread</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/assorted1crochetsize20cottonthread</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a9553b2d72c267f41b594a1b74d700ba.png?v=1652442858</image:loc>
      <image:title>Assorted Crochet Cotton Thread</image:title>
      <image:caption>assorted1crochetsize20cottonthread</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/nudecolorthickcottonthread</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/69f4adf41cb21784247c8d79e511f520.png?v=1652442939</image:loc>
      <image:title>Nude Cotton Thread</image:title>
      <image:caption>nudecolorthickcottonthread</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/sunyellowcolorthickcottonthread</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/8e977d85daafed12d450b0afe1aefc4b.png?v=1652442978</image:loc>
      <image:title>Sun Yellow Color  Cotton Thread</image:title>
      <image:caption>sunyellowcolorthickcottonthread</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/paleyellowcolorthickcottonthread</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/ae13fdc0b1044e346b4e2ed5e9b663cb.png?v=1652443018</image:loc>
      <image:title>Pale Yellow Color  Cotton Thread</image:title>
      <image:caption>paleyellowcolorthickcottonthread</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/limegreencolorthickcottonthread</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/20a63ad713fec89647dd468c10a329a4.png?v=1652443057</image:loc>
      <image:title>Lime Green Color  Cotton Thread</image:title>
      <image:caption>limegreencolorthickcottonthread</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/skybluecolorthickcottonthread</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/777d777a797b381560be31072e1f8b75.png?v=1652443095</image:loc>
      <image:title>Sky Blue Color  Cotton Thread</image:title>
      <image:caption>skybluecolorthickcottonthread</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/lavendercolorthickcottonthread</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/37cb37e14f4fc539358dc3aff163257e.png?v=1652443136</image:loc>
      <image:title>Lavender Color  Cotton Thread</image:title>
      <image:caption>lavendercolorthickcottonthread</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/muddybrowncolorthickcottonthread</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/e4d73849754254dcc6d263102f6049c7.png?v=1652443170</image:loc>
      <image:title>Muddy Brown Color  Cotton Thread</image:title>
      <image:caption>muddybrowncolorthickcottonthread</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/assorted2crochetsize20cottonthread</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/e065b4bea1b6d56e74358f060f7e6e53.png?v=1652443208</image:loc>
      <image:title>Assorted 2 Crochet Size 20 Cotton Thread</image:title>
      <image:caption>assorted2crochetsize20cottonthread</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/azurebluecolorthickcottonthread</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1d83e53000ace57e94602c1cdb9beb51.png?v=1652443239</image:loc>
      <image:title>Azure Blue Color  Cotton Thread</image:title>
      <image:caption>azurebluecolorthickcottonthread</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peachcolorthickcottonthread</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d1902caaf306510d339561c83258878f.png?v=1652443264</image:loc>
      <image:title>Peach Color  Cotton Thread</image:title>
      <image:caption>peachcolorthickcottonthread</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/flamingopinkcolorthickcottonthread</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/50fb2989c8e76d22c247c57c64159504.png?v=1652443293</image:loc>
      <image:title>Flamingo Pink Color  Cotton Thread</image:title>
      <image:caption>flamingopinkcolorthickcottonthread</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/bloodredpinkcolorthickcottonthread</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/33b0aa13850d7d8e70cffeebd2a2092b.png?v=1652443317</image:loc>
      <image:title>Blood Red Pink Color Cotton Thread</image:title>
      <image:caption>bloodredpinkcolorthickcottonthread</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/whitecolorthickcottonthread</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/23c9fd34362e696ea1413175d5ed63ce.png?v=1652443341</image:loc>
      <image:title>White Color  Cotton Thread</image:title>
      <image:caption>whitecolorthickcottonthread</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/offwhitecolorthickcottonthread</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/31e26608c91455e05bcd05d999261260.png?v=1652443365</image:loc>
      <image:title>Off White Color  Cotton Thread</image:title>
      <image:caption>offwhitecolorthickcottonthread</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/assortedcrochetcottonthreadcombo</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/573b3df3e665af396741df505c6a7fad.png?v=1652443394</image:loc>
      <image:title>Assorted Crochet Cotton Thread Combo</image:title>
      <image:caption>assortedcrochetcottonthreadcombo</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/tangerine-preciosa-hotfix-rhinestones-pihf000877</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Tangerine_20259_e73b248e-6979-42e4-bb74-f41cb90fc0f5.jpg?v=1652512196</image:loc>
      <image:title>Tangerine Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Tangerine Preciosa Hotfix Rhinestones (1628279898146)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/sunflower-preciosa-hotfix-rhinestones-pihf000871</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Sunflower_20292_8ebd90e5-a5b2-45d3-8639-622f586453df.jpg?v=1652512202</image:loc>
      <image:title>Sunflower Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Sunflower Preciosa Hotfix Rhinestones (1628279799842)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/siam-preciosa-hotfix-rhinestones-pihf000835</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Siam_20208_bd8ff71d-6a8c-4ffe-8ff8-b4f7eee7216f.jpg?v=1652512208</image:loc>
      <image:title>Siam Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Siam Preciosa Hotfix Rhinestones (1628279734306)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ruby-preciosa-hotfix-rhinestones-pihf000817</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Ruby_20501_0ed9dc92-2ad7-4cc2-9653-65cf41dc6f53.jpg?v=1652512213</image:loc>
      <image:title>Ruby Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Ruby Preciosa Hotfix Rhinestones (1628279636002)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/rose-peach-preciosa-hotfix-rhinestones-pihf000811</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Rose_20Peach_20262_5c475f14-4de0-4d77-920f-a26d4604093a.jpg?v=1652512219</image:loc>
      <image:title>Rose Peach Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Rose Peach Preciosa Hotfix Rhinestones (1628279570466)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/provence-lavender-preciosa-hotfix-rhinestones-pihf000793</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Provence_20Lavender_20283_93a775e2-115f-47ab-9a18-71ad853aa47b.jpg?v=1652512224</image:loc>
      <image:title>Provence Lavender Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Provence Lavender Preciosa Hotfix Rhinestones (1628279472162)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peridot-shimmer-preciosa-hotfix-rhinestones-pihf000787</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Peridot_20Shimmer_20214_20971_1179c70d-bbd0-4123-9dac-e28848ca534a.jpg?v=1652512229</image:loc>
      <image:title>Peridot Shimmer Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Peridot Shimmer Preciosa Hotfix Rhinestones (1628279439394)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-opal-preciosa-hotfix-rhinestones-pihf000919</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Yellow_20Opal_20231_42af5b90-45b0-451f-99ef-231344066b52.jpg?v=1652512234</image:loc>
      <image:title>Yellow Opal Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Yellow Opal Preciosa Hotfix Rhinestones (1628270690338)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-opal-preciosa-hotfix-rhinestones-pihf000913</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/White_20Opal_20234_8b042050-a88f-473a-a5b7-0260dcde2fa9.jpg?v=1652512240</image:loc>
      <image:title>White Opal Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>White Opal Preciosa Hotfix Rhinestones (1628270526498)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/vintage-rose-preciosa-hotfix-rhinestones-pihf000907</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Vintage_20Rose_20319_f7763f37-6dea-4773-b0fa-dd5041aae077.jpg?v=1652512246</image:loc>
      <image:title>Vintage Rose Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Vintage Rose Preciosa Hotfix Rhinestones (1628270460962)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/topaz-shimmer-preciosa-hotfix-rhinestones-pihf000901</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Topaz_20Shimmer_20203_20971_28618b31-ff7f-43ee-960f-e3125eeac8e5.jpg?v=1652512252</image:loc>
      <image:title>Topaz Shimmer Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Topaz Shimmer Preciosa Hotfix Rhinestones (1628270395426)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/topaz-preciosa-hotfix-rhinestones-pihf000895</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Topaz_20203_2ddcc82d-f089-4463-8378-7a965d0f4d3d.jpg?v=1652512257</image:loc>
      <image:title>Topaz Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Topaz Preciosa Hotfix Rhinestones (1628270362658)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/tanzanite-preciosa-hotfix-rhinestones-pihf000889</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Tanzanite_20539_464d2121-38a1-49ce-8831-3870fc701b7f.jpg?v=1652512262</image:loc>
      <image:title>Tanzanite Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Tanzanite Preciosa Hotfix Rhinestones (1628270264354)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/tangerine-shimmer-preciosa-hotfix-rhinestones-pihf000883</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Tangerine_20Shimmer_20259_20971_98c6f517-be06-4683-b841-8e8eddf1dc6b.jpg?v=1652512268</image:loc>
      <image:title>Tangerine Shimmer Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Tangerine Shimmer Preciosa Hotfix Rhinestones (1628270166050)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/smoky-mauve-preciosa-hotfix-rhinestones-pihf000865</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Smoky_20Mauve_20265_4b43d34c-7a0e-4c9f-99ce-9981ca430516.jpg?v=1652512276</image:loc>
      <image:title>Smoky Mauve Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Smoky Mauve Preciosa Hotfix Rhinestones (1628270034978)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/smoked-topaz-preciosa-hotfix-rhinestones-pihf000859</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Smoked_20Topaz_20220_423d8bdf-9539-4657-88f7-237110caac78.jpg?v=1652512281</image:loc>
      <image:title>Smoked Topaz Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Smoked Topaz Preciosa Hotfix Rhinestones (1628269969442)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silk-shimmer-preciosa-hotfix-rhinestones-pihf000853</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Silk_20Shimmer_20391_20971_bf257ab4-6842-4994-a56f-2331ee71a344.jpg?v=1652512287</image:loc>
      <image:title>Silk Shimmer Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Silk Shimmer Preciosa Hotfix Rhinestones (1628269903906)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silk-preciosa-hotfix-rhinestones-pihf000847</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Silk_20391_296c5dde-e9d7-49ef-919c-e98c75819873.jpg?v=1652512292</image:loc>
      <image:title>Silk Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Silk Preciosa Hotfix Rhinestones (1628269838370)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/siam-shimmer-preciosa-hotfix-rhinestones-pihf000841</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Siam_20Shimmer_20208_20971_e845d0b4-46f8-4bd9-b094-f4628e6124cd.jpg?v=1652512297</image:loc>
      <image:title>Siam Shimmer Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Siam Shimmer Preciosa Hotfix Rhinestones (1628269772834)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/sapphire-satin-preciosa-hotfix-rhinestones-pihf000829</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Sapphire_20Satin_20206_20SAT_e4248a10-23f6-430a-8285-24d9817d8035.jpg?v=1652512302</image:loc>
      <image:title>Sapphire Satin Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Sapphire Satin Preciosa Hotfix Rhinestones (1628269674530)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/sapphire-preciosa-hotfix-rhinestones-pihf000823</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Sapphire_20206_073ed6a7-c0b2-4949-b6f6-6f14f101836b.jpg?v=1652512308</image:loc>
      <image:title>Sapphire Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Sapphire Preciosa Hotfix Rhinestones (1628269576226)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/rose-preciosa-hotfix-rhinestones-pihf000805</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Rose_20209_07a3c931-2f47-43e5-a3c8-066e49a5bfc7.jpg?v=1652512313</image:loc>
      <image:title>Rose Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Rose Preciosa Hotfix Rhinestones (1628269477922)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/purple-velvet-preciosa-hotfix-rhinestones-pihf000799</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Purple_20Velvet_20277_5cdd7d92-bb67-4825-949f-2f0c4255b6d4.jpg?v=1652512318</image:loc>
      <image:title>Purple Velvet Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Purple Velvet Preciosa Hotfix Rhinestones (1628269314082)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peridot-preciosa-hotfix-rhinestones-pihf000781</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Peridot_20214_6112b370-fd5d-417c-b331-d64e362ebd7f.jpg?v=1652512324</image:loc>
      <image:title>Peridot Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Peridot Preciosa Hotfix Rhinestones (1628269117474)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/padparadscha-preciosa-hotfix-rhinestones-pihf000775</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Padparadscha_20524_b406f986-069c-4f7c-b7cb-31a0ca90d20f.jpg?v=1652512329</image:loc>
      <image:title>Padparadscha Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Padparadscha Preciosa Hotfix Rhinestones (1628268986402)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pacific-opal-preciosa-hotfix-rhinestones-pihf000769</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Pacific_20Opal_20390_96d745dc-7187-4b60-8736-2269ef0db477.jpg?v=1652512334</image:loc>
      <image:title>Pacific Opal Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Pacific Opal Preciosa Hotfix Rhinestones (1628268888098)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/olivine-preciosa-hotfix-rhinestones-pihf000763</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Olivine_20228_05ffdd78-a01d-4e4a-98ec-bc2daaa99273.jpg?v=1652512339</image:loc>
      <image:title>Olivine Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Olivine Preciosa Hotfix Rhinestones (1628268789794)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/montana-preciosa-hotfix-rhinestones-pihf000757</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Montana_20207_ba796f03-f227-4533-9e4c-e6d8024ee50c.jpg?v=1652512344</image:loc>
      <image:title>Montana Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Montana Preciosa Hotfix Rhinestones (1628268658722)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/mocca-preciosa-hotfix-rhinestones-pihf000751</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Mocca_20286_be2494ff-1eac-4458-b159-de7c9a0909f0.jpg?v=1652512349</image:loc>
      <image:title>Mocca Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Mocca Preciosa Hotfix Rhinestones (1628268560418)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-turquoise-preciosa-hotfix-rhinestones-pihf000745</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Light_20Turquoise_20263_594fd402-d267-4394-b2ef-7f5d058ffb85.jpg?v=1652512354</image:loc>
      <image:title>Light Turquoise Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Light Turquoise Preciosa Hotfix Rhinestones (1628268494882)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-topaz-preciosa-hotfix-rhinestones-pihf000739</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Light_20Topaz_20226_42863e7e-aa9c-49c2-8fda-5a3336ef5085.jpg?v=1652512359</image:loc>
      <image:title>Light Topaz Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Light Topaz Preciosa Hotfix Rhinestones (1628268429346)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-silk-preciosa-hotfix-rhinestones-pihf000733</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Light_20Silk_20261_8f7ae601-aa40-414f-abef-f4168f1327dc.jpg?v=1652512367</image:loc>
      <image:title>Light Silk Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Light Silk Preciosa Hotfix Rhinestones (1628268363810)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-siam-shimmer-preciosa-hotfix-rhinestones-pihf000727</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Light_20Siam_20Shimmer_20227_20971_a49b7396-786c-4fb3-9856-b5616f4db331.jpg?v=1652512373</image:loc>
      <image:title>Light Siam Shimmer Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Light Siam Shimmer Preciosa Hotfix Rhinestones (1628268265506)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-siam-satin-preciosa-hotfix-rhinestones-pihf000721</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Light_20Siam_20Satin_20227_20SAT_ff2edc23-8426-4c3a-8166-3bfb9af47b34.jpg?v=1652512377</image:loc>
      <image:title>Light Siam Satin Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Light Siam Satin Preciosa Hotfix Rhinestones (1628268199970)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-siam-aurore-boreale-preciosa-hotfix-rhinestones-pihf000715</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Light_20Siam_20Aurore_20Boreale_20227_20AB_4cdcde89-0935-4d3f-a2c6-93ee752c2505.jpg?v=1652512382</image:loc>
      <image:title>Light Siam Aurore Boreale Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Light Siam Aurore Boreale Preciosa Hotfix Rhinestones (1628268134434)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-siam-preciosa-hotfix-rhinestones-pihf000709</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Light_20Siam_20227_18cf82b0-3fec-4bef-9bda-6318d756a93c.jpg?v=1652512387</image:loc>
      <image:title>Light Siam Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Light Siam Preciosa Hotfix Rhinestones (1628268068898)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-sapphire-shimmer-preciosa-hotfix-rhinestones-pihf000703</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Light_20Sapphire_20Shimmer_20211_20971_2f7d839e-578d-49d3-94ea-4f5d7a55b4ec.jpg?v=1652512393</image:loc>
      <image:title>Light Sapphire Shimmer Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Light Sapphire Shimmer Preciosa Hotfix Rhinestones (1628268003362)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-sapphire-preciosa-hotfix-rhinestones-pihf000697</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Light_20Sapphire_20211_f40dcb6c-de88-4e9c-809b-e755f8c325a0.jpg?v=1652512399</image:loc>
      <image:title>Light Sapphire Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Light Sapphire Preciosa Hotfix Rhinestones (1628267937826)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-rose-aurore-boreale-preciosa-hotfix-rhinestones-pihf000691</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Light_20Rose_20Aurore_20Boreale_20223_20AB_8c61e053-ec7e-4ec9-bd89-346210e3f40b.jpg?v=1652512404</image:loc>
      <image:title>Light Rose Aurore Boreale Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Light Rose Aurore Boreale Preciosa Hotfix Rhinestones (1628267872290)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-rose-preciosa-hotfix-rhinestones-pihf000685</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Light_20Rose_20223_127a7498-9ed2-4680-9bfc-d87aecbd3b79.jpg?v=1652512409</image:loc>
      <image:title>Light Rose Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Light Rose Preciosa Hotfix Rhinestones (1628267741218)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-peach-preciosa-hotfix-rhinestones-pihf000679</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Light_20Peach_20362_96e346fc-53e8-4b24-a7c6-c25ea5ff07d0.jpg?v=1652512414</image:loc>
      <image:title>Light Peach Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Light Peach Preciosa Hotfix Rhinestones (1628267675682)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-grey-opal-preciosa-hotfix-rhinestones-pihf000673</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Light_20Grey_20Opal_20383_b96a8a2e-003f-4c14-944f-73addaf70a05.jpg?v=1652512419</image:loc>
      <image:title>Light Grey Opal Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Light Grey Opal Preciosa Hotfix Rhinestones (1628267610146)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-colorado-topaz-shimmer-preciosa-hotfix-rhinestones-pihf000667</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Light_20Colorado_20Topaz_20Shimmer_20246_20971_25cc3fa9-1fd5-4c21-b61b-7851351c2a2d.jpg?v=1652512425</image:loc>
      <image:title>Light Colorado Topaz Shimmer Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Light Colorado Topaz Shimmer Preciosa Hotfix Rhinestones (1628267544610)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-colorado-topaz-preciosa-hotfix-rhinestones-pihf000661</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Light_20Colorado_20Topaz_20246_b8d88dd7-3d7f-4d62-be20-7482c7933ede.jpg?v=1652512430</image:loc>
      <image:title>Light Colorado Topaz Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Light Colorado Topaz Preciosa Hotfix Rhinestones (1628267479074)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-amethyst-preciosa-hotfix-rhinestones-pihf000655</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Light_20Amethyst_20212_746b02ec-7547-4856-b771-59da6b8d40cf.jpg?v=1652512436</image:loc>
      <image:title>Light Amethyst Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Light Amethyst Preciosa Hotfix Rhinestones (1628267413538)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/khaki-preciosa-hotfix-rhinestones-pihf000649</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Khaki_20550_306952c4-ed3a-4d90-9be4-db86dd027a7f.jpg?v=1652512442</image:loc>
      <image:title>Khaki Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Khaki Preciosa Hotfix Rhinestones (1628267282466)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/jonquil-satin-preciosa-hotfix-rhinestones-pihf000643</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Jonquil_20Satin_20213_f9fcfc4e-8c9f-4c69-bbe1-2d0aa267fdc7.jpg?v=1652512447</image:loc>
      <image:title>Jonquil Satin Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Jonquil Satin Preciosa Hotfix Rhinestones (1628267216930)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/jonquil-aurore-boreale-preciosa-hotfix-rhinestones-pihf000637</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Jonquil_20Aurore_20Boreale_20213_20AB_2909eb38-9831-48a9-84cc-fae0e04343dc.jpg?v=1652512453</image:loc>
      <image:title>Jonquil Aurore Boreale Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Jonquil Aurore Boreale Preciosa Hotfix Rhinestones (1628267151394)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/jonquil-preciosa-hotfix-rhinestones-pihf000631</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Jonquil_20213_445f7585-4c70-4fd7-bb76-a8d50da2ca85.jpg?v=1652512458</image:loc>
      <image:title>Jonquil Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Jonquil Preciosa Hotfix Rhinestones (1628267053090)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/jet-nut-preciosa-hotfix-rhinestones-pihf000625</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Jet_20Nut_20280_20NUT_d319c130-8e66-4279-99d0-ff6c86fbe0bf.jpg?v=1652512464</image:loc>
      <image:title>Jet Nut Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Jet Nut Preciosa Hotfix Rhinestones (1628266987554)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/jet-hematite-preciosa-hotfix-rhinestones-pihf000619</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Jet_20Hematite_20280_20HEM_45969d4f-006f-4dc2-bc9a-0475a17ada7d.jpg?v=1652512469</image:loc>
      <image:title>Jet Hematite Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Jet Hematite Preciosa Hotfix Rhinestones (1628266889250)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/jet-hematite-preciosa-hotfix-rhinestones-pihf000613</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Jet_20Hematite_20280_20HEM_20_20Cabochons_20_7b252e76-6010-424d-b87b-08f50d2419a2.jpg?v=1652512474</image:loc>
      <image:title>Jet Hematite Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Jet Hematite Preciosa Hotfix Rhinestones (1628266758178)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/jet-aurore-boreale-preciosa-hotfix-rhinestones-pihf000607</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Jet_20Aurore_20Boreale_20280_20AB_dc75a0d7-f69b-470b-81a3-da9998387101.jpg?v=1652512479</image:loc>
      <image:title>Jet Aurore Boreale Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Jet Aurore Boreale Preciosa Hotfix Rhinestones (1628266659874)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/jet-preciosa-hotfix-rhinestones-pihf000601</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Jet_20280_88fd45b7-dd66-4ba8-aecf-9b3009796ac2.jpg?v=1652512484</image:loc>
      <image:title>Jet Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Jet Preciosa Hotfix Rhinestones (1628266561570)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/jet-cabochons-preciosa-hotfix-rhinestones-pihf000595</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Jet_20280_20_20Cabochons_20_1aaa2bf6-7566-4b23-be2e-cfbc70ce02c2.jpg?v=1652512489</image:loc>
      <image:title>Jet Cabochons Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Jet Cabochons Preciosa Hotfix Rhinestones (1628266463266)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/indian-siam-preciosa-hotfix-rhinestones-pihf000589</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Indian_20Siam_20327_bdfd60b8-3ab6-416c-a7c8-de712fedecb4.jpg?v=1652512494</image:loc>
      <image:title>Indian Siam Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Indian Siam Preciosa Hotfix Rhinestones (1628266364962)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/indian-pink-preciosa-hotfix-rhinestones-pihf000583</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Indian_20Pink_20289_f81f4de3-f1bf-41ef-8341-29ff8a310160.jpg?v=1652512499</image:loc>
      <image:title>Indian Pink Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Indian Pink Preciosa Hotfix Rhinestones (1628266299426)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/hyacinth-shimmer-preciosa-hotfix-rhinestones-pihf000577</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Hyacinth_20Shimmer_20236_20971_c9223faa-b6d3-4e18-9e79-f1aef9bc7605.jpg?v=1652512504</image:loc>
      <image:title>Hyacinth Shimmer Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Hyacinth Shimmer Preciosa Hotfix Rhinestones (1628266233890)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/hyacinth-preciosa-hotfix-rhinestones-pihf000571</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Hyacinth_20236_4f315e09-445b-4235-bb88-a6f8c54fc8e7.jpg?v=1652512509</image:loc>
      <image:title>Hyacinth Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Hyacinth Preciosa Hotfix Rhinestones (1628266168354)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/greige-preciosa-hotfix-rhinestones-pihf000565</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Greige_20284_b01522f6-d8d3-4e2a-a566-0c850ee3f430.jpg?v=1652512513</image:loc>
      <image:title>Greige Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Greige Preciosa Hotfix Rhinestones (1628266070050)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/graphite-preciosa-hotfix-rhinestones-pihf000559</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Graphite_20253_0cbe9711-eb80-40c4-ba27-e3a7dc527ab6.jpg?v=1652512519</image:loc>
      <image:title>Graphite Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Graphite Preciosa Hotfix Rhinestones (1628265971746)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fuchsiashimmer-preciosa-hotfix-rhinestones-pihf000553</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/FuchsiaShimmer_20502_20971_421f6c35-3639-4912-a3b6-8d1f287f7582.jpg?v=1652512524</image:loc>
      <image:title>FuchsiaShimmer Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>FuchsiaShimmer Preciosa Hotfix Rhinestones (1628265906210)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fuchsia-preciosa-hotfix-rhinestones-pihf000547</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Fuchsia_20502_571f04b1-f80b-4186-b8c7-6e6d396e0039.jpg?v=1652512529</image:loc>
      <image:title>Fuchsia Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Fuchsia Preciosa Hotfix Rhinestones (1628265873442)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fireopal-preciosa-hotfix-rhinestones-pihf000541</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Fireopal_20237_5d9a361e-cc6c-4d1b-98b1-6bf98d33ef62.jpg?v=1652512535</image:loc>
      <image:title>Fireopal Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Fireopal Preciosa Hotfix Rhinestones (1628265807906)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fern-green-preciosa-hotfix-rhinestones-pihf000535</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Fern_20Green_20291_a8f7fec1-6a5c-4106-b467-fcd7f8945c35.jpg?v=1652512540</image:loc>
      <image:title>Fern Green Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Fern Green Preciosa Hotfix Rhinestones (1628265742370)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/erinite-shimmer-preciosa-hotfix-rhinestones-pihf000529</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Erinite_20Shimmer_20360_20971_184865ae-c7e5-4e4c-92fe-ae3f5e76d078.jpg?v=1652512546</image:loc>
      <image:title>Erinite Shimmer Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Erinite Shimmer Preciosa Hotfix Rhinestones (1628265644066)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/erinite-preciosa-hotfix-rhinestones-pihf000523</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Erinite_20360_b8db42fa-e622-4716-8313-af582ef1e023.jpg?v=1652512551</image:loc>
      <image:title>Erinite Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Erinite Preciosa Hotfix Rhinestones (1628265578530)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/emerald-preciosa-hotfix-rhinestones-pihf000517</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Emerald_20205_8a7d6eb5-a6e4-4d19-a64e-d18bc494a6bb.jpg?v=1652512556</image:loc>
      <image:title>Emerald Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Emerald Preciosa Hotfix Rhinestones (1628265512994)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/denim-blue-preciosa-hotfix-rhinestones-pihf000511</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Denim_20Blue_20266_47e6a387-f0fc-4272-8378-c696a9686e75.jpg?v=1652512562</image:loc>
      <image:title>Denim Blue Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Denim Blue Preciosa Hotfix Rhinestones (1628265381922)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-indigo-preciosa-hotfix-rhinestones-pihf000505</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Dark_20Indigo_20288_6f013ac4-9252-4146-ba61-b35f16396c91.jpg?v=1652512567</image:loc>
      <image:title>Dark Indigo Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Dark Indigo Preciosa Hotfix Rhinestones (1628265316386)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crytsal-dorado-preciosa-hotfix-rhinestones-pihf000499</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crytsal_20Dorado_20001_20DOR_7d5be42a-b9e5-45b1-8f54-45ed675bf503.jpg?v=1652512573</image:loc>
      <image:title>Crytsal Dorado Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crytsal Dorado Preciosa Hotfix Rhinestones (1628265218082)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crytsal-blue-shade-preciosa-hotfix-rhinestones-pihf000493</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crytsal_20Blue_20Shade_20001_20BLSH_5f03e7d9-d632-4e2c-a91e-ea308ee1d649.jpg?v=1652512578</image:loc>
      <image:title>Crytsal Blue Shade Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crytsal Blue Shade Preciosa Hotfix Rhinestones (1628265152546)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-white-pearl-preciosa-hotfix-rhinestones-pihf000487</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20White_20Pearl_20001_20650_773f1d6e-8642-449d-a4e4-9e2c819e68b2.jpg?v=1652512584</image:loc>
      <image:title>Crystal White Pearl Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal White Pearl Preciosa Hotfix Rhinestones (1628265054242)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-white-patina-preciosa-hotfix-rhinestones-pihf000481</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20White_20Patina_20001_20WHIPA_b240de6e-f3ed-4768-aa70-07fecfc9fa81.jpg?v=1652512589</image:loc>
      <image:title>Crystal White Patina Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal White Patina Preciosa Hotfix Rhinestones (1628264955938)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-volcano-preciosa-hotfix-rhinestones-pihf000475</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Volcano_20001_20VOL_595e522a-878e-4085-ae99-1a6fe97083c3.jpg?v=1652512594</image:loc>
      <image:title>Crystal Volcano Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Volcano Preciosa Hotfix Rhinestones (1628264890402)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-transmission-hotfix-transparent-preciosa-hotfix-rhinestones-pihf000469</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Transmission_20Hotfix_20Transparent_20001_20TRA_20HFT_5155870a-2c8c-467f-a9f2-3ce7b7435437.jpg?v=1652512599</image:loc>
      <image:title>Crystal Transmission Hotfix Flatback Rhinestone Crystal Transparent Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Transmission Hotfix Transparent Preciosa Hotfix Rhinestones (1628264857634)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-summer-blue-preciosa-hotfix-rhinestones-pihf000463</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Summer_20Blue_20001_20L114S_55131b81-f33d-4362-93f1-76af9521de68.jpg?v=1652512604</image:loc>
      <image:title>Crystal Summer Blue Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Summer Blue Preciosa Hotfix Rhinestones (1628264792098)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-silver-shade-preciosa-hotfix-rhinestones-pihf000457</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Silver_20Shade_20001_20SSHA_be28df3c-5d18-475a-ba41-dc044ce446b0.jpg?v=1652512609</image:loc>
      <image:title>Crystal Silver Shade Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Silver Shade Preciosa Hotfix Rhinestones (1628264726562)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-silver-patina-preciosa-hotfix-rhinestones-pihf000451</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Silver_20Patina_20001_20SILPA_766929ab-11af-40eb-9bd5-3d2a08681c42.jpg?v=1652512613</image:loc>
      <image:title>Crystal Silver Patina Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Silver Patina Preciosa Hotfix Rhinestones (1628264661026)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-silver-night-preciosa-hotfix-rhinestones-pihf000445</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Silver_20Night_20001_20SINI_7cfb17f3-83db-4894-8e96-3ee416ded892.jpg?v=1652512619</image:loc>
      <image:title>Crystal Silver Night Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Silver Night Preciosa Hotfix Rhinestones (1628264595490)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-scarabaeus-green-preciosa-hotfix-rhinestones-pihf000439</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Scarabaeus_20Green_20001_20SCGR_9707b060-f874-4c50-bb37-bef3c240b7d4.jpg?v=1652512624</image:loc>
      <image:title>Crystal Scarabaeus Green Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Scarabaeus Green Preciosa Hotfix Rhinestones (1628264497186)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-scarabaeus-green-preciosa-hotfix-rhinestones-pihf000433</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Scarabaeus_20Green_20001_20SCGR_20_20Cabochons_20_068d33b6-c979-4b21-90b1-c719fd8f6d29.jpg?v=1652512629</image:loc>
      <image:title>Crystal Scarabaeus Green Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Scarabaeus Green Preciosa Hotfix Rhinestones (1628264431650)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-royal-red-preciosa-hotfix-rhinestones-pihf000427</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Royal_20Red_20001_20L107S_9a0156d0-0547-489a-a598-0e74767d9bba.jpg?v=1652512634</image:loc>
      <image:title>Crystal Royal Red Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Royal Red Preciosa Hotfix Rhinestones (1628264333346)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-royal-green-preciosa-hotfix-rhinestones-pihf000421</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Royal_20Green_20001_20L109S_334d369f-2f9e-40a5-9e3f-049a815fdbdf.jpg?v=1652512639</image:loc>
      <image:title>Crystal Royal Green Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Royal Green Preciosa Hotfix Rhinestones (1628264169506)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-royal-blue-preciosa-hotfix-rhinestones-pihf000415</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Royal_20Blue_20001_20L110S_5ae5d4d2-c51e-41a8-8078-1a2e60bf7f8f.jpg?v=1652512645</image:loc>
      <image:title>Crystal Royal Blue Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Royal Blue Preciosa Hotfix Rhinestones (1628264038434)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-rose-patina-preciosa-hotfix-rhinestones-pihf000409</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Rose_20Patina_20001_20ROSPA_dd682faf-649d-4f2f-842c-da7f8360d9da.jpg?v=1652512650</image:loc>
      <image:title>Crystal Rose Patina Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Rose Patina Preciosa Hotfix Rhinestones (1628263972898)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-rose-gold-preciosa-hotfix-rhinestones-pihf000403</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Rose_20Gold_20001_20ROGL_6315808d-0c84-4250-aa39-95c18d28c2ae.jpg?v=1652512656</image:loc>
      <image:title>Crystal Rose Gold Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Rose Gold Preciosa Hotfix Rhinestones (1628263874594)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-rosaline-pearl-preciosa-hotfix-rhinestones-pihf000397</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Rosaline_20Pearl_20001_20294_73eccd57-dbf8-4616-863e-405f6baf0ae5.jpg?v=1652512661</image:loc>
      <image:title>Crystal Rosaline Pearl Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Rosaline Pearl Preciosa Hotfix Rhinestones (1628263809058)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-rainbow-dark-preciosa-hotfix-rhinestones-pihf000391</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Rainbow_20Dark_20001_20RABDK_2916e3a5-d242-4c29-b864-6d8a1a7ee267.jpg?v=1652512667</image:loc>
      <image:title>Crystal Rainbow Dark Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Rainbow Dark Preciosa Hotfix Rhinestones (1628263743522)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-powder-yellow-preciosa-hotfix-rhinestones-pihf000385</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Powder_20Yellow_20001_20L101_be41a81b-95eb-4ac9-b40c-d78e7bc9c1ff.jpg?v=1652512672</image:loc>
      <image:title>Crystal Powder Yellow Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Powder Yellow Preciosa Hotfix Rhinestones (1628263677986)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-powder-rose-preciosa-hotfix-rhinestones-pihf000379</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Powder_20Rose_20_20001_20L103_4a268f06-823d-4cce-97db-0f3677ef7b48.jpg?v=1652512677</image:loc>
      <image:title>Crystal Powder Rose Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Powder Rose Preciosa Hotfix Rhinestones (1628263579682)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-powder-rose-preciosa-hotfix-rhinestones-pihf000373</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Powder_20Rose_20_20001_20L103_64ae269f-a15b-4883-921a-a0bd0768312d.jpg?v=1652512682</image:loc>
      <image:title>Crystal Powder Rose Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Powder Rose Preciosa Hotfix Rhinestones (1628263514146)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-powder-green-preciosa-hotfix-rhinestones-pihf000367</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Powder_20Green_20001_20L102_846b4ed5-ac53-4867-9fc6-cfeedfbcd482.jpg?v=1652512687</image:loc>
      <image:title>Crystal Powder Green Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Powder Green Preciosa Hotfix Rhinestones (1628263448610)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-powder-green-preciosa-hotfix-rhinestones-pihf000361</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Powder_20Green_20001_20L102_20_20Cabochons_20_b4d15a95-c6f1-4631-8b01-08bb359be268.jpg?v=1652512693</image:loc>
      <image:title>Crystal Powder Green Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Powder Green Preciosa Hotfix Rhinestones (1628263383074)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-powder-blue-preciosa-hotfix-rhinestones-pihf000355</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Powder_20Blue_20001_20L104_332b0ecd-d42c-48aa-9e8e-e276883326b1.jpg?v=1652512698</image:loc>
      <image:title>Crystal Powder Blue Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Powder Blue Preciosa Hotfix Rhinestones (1628263252002)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-powder-blue-preciosa-hotfix-rhinestones-pihf000349</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Powder_20Blue_20001_20L104_20_20Cabochons_20_fbd25a3f-8dff-4e23-acb4-2d9829896757.jpg?v=1652512703</image:loc>
      <image:title>Crystal Powder Blue Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Powder Blue Preciosa Hotfix Rhinestones (1628263186466)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-peony-pink-preciosa-hotfix-rhinestones-pihf000343</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Peony_20Pink_20001_20L113S_7ca1c684-1c01-488e-a633-6317d300641a.jpg?v=1652512708</image:loc>
      <image:title>Crystal Peony Pink Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Peony Pink Preciosa Hotfix Rhinestones (1628263120930)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-brown-drop-2-hole-glass-beads-18x25-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-14-12-48-26_product_1_1652512706652.jpg?v=1746426742</image:loc>
      <image:title>Light Brown Drop 2 Hole Glass Stones- 18x25 mm</image:title>
      <image:caption>light-brown-drop-2-hole-glass-beads-18x25-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-paradise-shine-preciosa-hotfix-rhinestones-pihf000337</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Paradise_20Shine_20001_20PARSH_6785cb14-4e87-46e0-9387-7d11d41acfde.jpg?v=1652512714</image:loc>
      <image:title>Crystal Paradise Shine Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Paradise Shine Preciosa Hotfix Rhinestones (1628263055394)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-nacre-preciosa-hotfix-rhinestones-pihf000331</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Nacre_20001_20191_aae20349-155c-4281-855b-3cc88ab44181.jpg?v=1652512719</image:loc>
      <image:title>Crystal Nacre Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Nacre Preciosa Hotfix Rhinestones (1628262957090)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-moonlight-preciosa-hotfix-rhinestones-pihf000325</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Moonlight_20001_20MOL_11a0d98e-a1fb-4bab-9ee1-f6134fd1edc3.jpg?v=1652512724</image:loc>
      <image:title>Crystal Moonlight Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Moonlight Preciosa Hotfix Rhinestones (1628262891554)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-metallic-sunshine-preciosa-hotfix-rhinestones-pihf000313</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Metallic_20Sunshine_20001_20METSH_aaca07fa-4412-47e4-bca1-d810eb9783ea.jpg?v=1652512734</image:loc>
      <image:title>Crystal Metallic Sunshine Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Metallic Sunshine Preciosa Hotfix Rhinestones (1628262793250)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-metallic-light-gold-preciosa-hotfix-rhinestones-pihf000307</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Metallic_20Light_20Gold_20001_20MLGLD_208c89f5-9a67-453e-9a66-d15e9114604e.jpg?v=1652512739</image:loc>
      <image:title>Crystal Metallic Light Gold Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Metallic Light Gold Preciosa Hotfix Rhinestones (1628262727714)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-metallic-blue-preciosa-hotfix-rhinestones-pihf000301</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Metallic_20Blue_20001_20METBL_f42efd27-c609-42e9-8980-5dc4f46a8429.jpg?v=1652512745</image:loc>
      <image:title>Crystal Metallic Blue Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Metallic Blue Preciosa Hotfix Rhinestones (1628262629410)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-meridian-blue-preciosa-hotfix-rhinestones-pihf000295</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Meridian_20Blue_20001_20MBL_c648ed8d-f7ef-4777-aaaf-1b51b6c7d466.jpg?v=1652512750</image:loc>
      <image:title>Crystal Meridian Blue Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Meridian Blue Preciosa Hotfix Rhinestones (1628262531106)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-luminous-green-preciosa-hotfix-rhinestones-pihf000289</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Luminous_20Green_20001_20LUMG_a479b153-7f52-41cd-916c-245281748a5d.jpg?v=1652512756</image:loc>
      <image:title>Crystal Luminous Green Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Luminous Green Preciosa Hotfix Rhinestones (1628262465570)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-lilac-shadow-preciosa-hotfix-rhinestones-pihf000283</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Lilac_20Shadow_20001_20LISH_6c48fdaf-a066-458d-b6c6-8650db4e1d9d.jpg?v=1652512762</image:loc>
      <image:title>Crystal Lilac Shadow Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Lilac Shadow Preciosa Hotfix Rhinestones (1628262400034)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-light-grey-pearl-preciosa-hotfix-rhinestones-pihf000277</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Light_20Grey_20Pearl_20001_20616_a6fa305c-4bab-4c01-ae3b-938452ea5590.jpg?v=1652512767</image:loc>
      <image:title>Crystal Light Grey Pearl Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Light Grey Pearl Preciosa Hotfix Rhinestones (1628262367266)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-light-coral-preciosa-hotfix-rhinestones-pihf000271</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Light_20Coral_20001_20L116S_b1e731f9-02f5-4e72-af8d-71a6f06e82b8.jpg?v=1652512773</image:loc>
      <image:title>Crystal Light Coral Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Light Coral Preciosa Hotfix Rhinestones (1628262301730)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-light-chrome-preciosa-hotfix-rhinestones-pihf000265</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Light_20Chrome_20001_20LTCH_d1f115ed-5ad9-475b-a22c-117b0c1c0a93.jpg?v=1652512779</image:loc>
      <image:title>Crystal Light Chrome Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Light Chrome Preciosa Hotfix Rhinestones (1628262236194)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-ivory-cream-preciosa-hotfix-rhinestones-pihf000259</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Ivory_20Cream_20001_20L106S_f522010d-568c-4e2e-983d-b93e497a0213.jpg?v=1652512784</image:loc>
      <image:title>Crystal Ivory Cream Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Ivory Cream Preciosa Hotfix Rhinestones (1628262170658)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-iridescent-green-preciosa-hotfix-rhinestones-pihf000253</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Iridescent_20Green_20001_20IRIG_e5b71219-bc74-4c6e-8650-788256fddfb6.jpg?v=1652512789</image:loc>
      <image:title>Crystal Iridescent Green Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Iridescent Green Preciosa Hotfix Rhinestones (1628262105122)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-hotfix-transparent-preciosa-hotfix-rhinestones-pihf000247</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Hotfix_20Transparent_20001_20HFT_3480e76c-e4f2-44a7-9937-3436f2f61e9e.jpg?v=1652512794</image:loc>
      <image:title>Crystal Hotfix Flatback Rhinestone Crystal Transparent Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Hotfix Transparent Preciosa Hotfix Rhinestones (1628262006818)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-golden-shadow-preciosa-hotfix-rhinestones-pihf000241</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Golden_20Shadow_20001_20GSHA_62d27a0d-e8fd-4d67-a350-8c76054990d2.jpg?v=1652512801</image:loc>
      <image:title>Crystal Golden Shadow Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Golden Shadow Preciosa Hotfix Rhinestones (1628261941282)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-golden-shadow-preciosa-hotfix-rhinestones-pihf000235</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Golden_20Shadow_20001_20GSHA_20_20Cobochons_20_79a6e7f0-0226-4bac-8604-8f2b9e0d9b72.jpg?v=1652512806</image:loc>
      <image:title>Crystal Golden Shadow Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Golden Shadow Preciosa Hotfix Rhinestones (1628261810210)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-gold-patina-preciosa-hotfix-rhinestones-pihf000229</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Gold_20Patina_20001_20GOLPA_431ee777-5994-4ac5-96b1-32d30f685525.jpg?v=1652512812</image:loc>
      <image:title>Crystal Gold Patina Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Gold Patina Preciosa Hotfix Rhinestones (1628261646370)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-dark-red-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Dark_20Red_20001_20L108S_38783c45-1f69-4f0a-ba23-4e4bc0b9e804.jpg?v=1652512817</image:loc>
      <image:title>Crystal Dark Red Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Dark Red Preciosa Hotfix Rhinestones (1621659123746)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-dark-gray-pearl-cabochon-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Dark_20Grey_20Pearl_20001_20617_8700da91-4ed9-4086-b6ba-9804940b21c8.jpg?v=1652512822</image:loc>
      <image:title>Crystal Dark Gray Pearl Cabochon Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Dark Gray Pearl Cabochon Preciosa Hotfix Rhinestones (1621659058210)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-dark-gray-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Dark_20Grey_20001_20L111S_24bc5b5f-3999-4970-b915-b4308f01436b.jpg?v=1652512828</image:loc>
      <image:title>Crystal Dark Gray Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Dark Gray Preciosa Hotfix Rhinestones (1621658992674)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-cream-pearl-cabochon-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Creampearl_20001_20291_c5570f7a-a367-4592-a9dd-0512b9ed2942.jpg?v=1652512834</image:loc>
      <image:title>Crystal Cream Pearl Cabochon Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Cream Pearl Cabochon Preciosa Hotfix Rhinestones (1621658959906)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-cosmojet-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Cosmojet_20001_20COS_1fcc06f9-4466-48dc-833e-458f27c83098.jpg?v=1652512839</image:loc>
      <image:title>Crystal Cosmojet Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Cosmojet Preciosa Hotfix Rhinestones (1621658927138)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-copper-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Copper_20001_20COP_98f8e3f9-971d-43d0-a858-b37df943be26.jpg?v=1652512844</image:loc>
      <image:title>Crystal Copper Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Copper Preciosa Hotfix Rhinestones (1621658894370)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-orange-drop-2-hole-glass-beads-18x25-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-14-12-50-45_product_1_1652512845472.jpg?v=1652512852</image:loc>
      <image:title>Peach Orange Drop 2 Hole Glass Stones- 18x25 mm</image:title>
      <image:caption>peach-orange-drop-2-hole-glass-beads-18x25-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-bronze-pearl-cabochon-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Broze_20Pearl_20001_20295_fae6fd5e-09be-419a-ab8a-0f97aa099d5a.jpg?v=1652512850</image:loc>
      <image:title>Crystal Bronze Pearl Cabochon Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Bronze Pearl Cabochon Preciosa Hotfix Rhinestones (1621658861602)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-bronze-shade-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Bronze_20Shade_20001_20BRSH_da771d8b-d1b9-408d-96ab-48cdf6e82b54.jpg?v=1652512856</image:loc>
      <image:title>Crystal Bronze Shade Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Bronze Shade Preciosa Hotfix Rhinestones (1621658796066)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-black-patina-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Black_20Patina_20001_20BLAPA_e100dc81-9e14-45a0-b734-71e6edb402a7.jpg?v=1652512861</image:loc>
      <image:title>Crystal Black Patina Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Black Patina Preciosa Hotfix Rhinestones (1621658763298)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-bermuda-blue-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Bermuda_20Blue_20001_20BBL_aafdebfa-6ad7-46f2-82ae-2ce93e529683.jpg?v=1652512866</image:loc>
      <image:title>Crystal Bermuda Blue Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Bermuda Blue Preciosa Hotfix Rhinestones (1621658730530)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-azure-blue-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Azure_20Blue_20001_20L112S_15c003cc-18cf-438d-9c9b-3c0f226b23e8.jpg?v=1652512871</image:loc>
      <image:title>Crystal Azure Blue Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Azure Blue Preciosa Hotfix Rhinestones (1621658632226)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-aurore-boreale-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Aurore_20Boreale_20001_20AB_f33070fc-62a0-4696-9e44-c17dd8bd81b0.jpg?v=1652512876</image:loc>
      <image:title>Crystal Aurore Boreale Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Aurore Boreale Preciosa Hotfix Rhinestones (1621658599458)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-antique-pink-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20Antique_20Pink_20001_20ANTP_6ea68606-9e1b-46ac-b416-0105ef383f26.jpg?v=1652512881</image:loc>
      <image:title>Crystal Antique Pink Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Antique Pink Preciosa Hotfix Rhinestones (1621658566690)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crystal_20001_da35d8da-4e5e-4ced-a3b8-cdfb7d82af28.jpg?v=1652512887</image:loc>
      <image:title>Crystal Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Preciosa Hotfix Rhinestones (1621658533922)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crystal-shimmer-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Crsytal_20Shimmer_20001_20971_dcec7379-9271-4c68-b96c-4792f7b34ede.jpg?v=1652512892</image:loc>
      <image:title>Crystal Shimmer Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crystal Shimmer Preciosa Hotfix Rhinestones (1621658501154)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cobalt-shimmer-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Cobalt_20Shimmer_20369_20971_f42b9de8-5470-4d49-8ce2-155ef4ab473a.jpg?v=1652512897</image:loc>
      <image:title>Cobalt Blue Shimmer Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Cobalt Shimmer Preciosa Hotfix Rhinestones (1621658468386)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cobalt-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Cobalt_20369_69551960-d696-4129-b5d8-cd86d703b118.jpg?v=1652512903</image:loc>
      <image:title>Cobalt Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Cobalt Preciosa Hotfix Rhinestones (1621658402850)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/citrine-shimmer-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Citrine_20Shimmer_20249_20971_ac7a812c-7231-4f71-8376-018f97d45547.jpg?v=1652512908</image:loc>
      <image:title>Citrine Shimmer Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Citrine Shimmer Preciosa Hotfix Rhinestones (1621658370082)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/citrine-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Citrine_20249_0dd28153-a448-4aaa-ae19-7d8ed4d7facb.jpg?v=1652512914</image:loc>
      <image:title>Citrine Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Citrine Preciosa Hotfix Rhinestones (1621658337314)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/chrysolite-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Chrysolite_20238_d324a26f-c8a2-4836-b9ab-268334ad4457.jpg?v=1652512919</image:loc>
      <image:title>Chrysolite Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Chrysolite Preciosa Hotfix Rhinestones (1621658173474)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/chalk-white-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/ChalkWhite_20279_b1618f8b-faf3-40ad-b050-74fca2600436.jpg?v=1652512925</image:loc>
      <image:title>Chalk White Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Chalk White Preciosa Hotfix Rhinestones (1621658075170)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/capri-blue-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Capri_20Blue_20243_ea48f17d-fe0b-45eb-b8a2-6284b5eb7d84.jpg?v=1652512930</image:loc>
      <image:title>Capri Blue Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Capri Blue Preciosa Hotfix Rhinestones (1621658009634)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/burgundy-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Burgundy_20515_9e8a69d0-2d9d-403d-b7d4-e4f2cf182950.jpg?v=1652512937</image:loc>
      <image:title>Burgundy Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Burgundy Preciosa Hotfix Rhinestones (1621657944098)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blush-rose-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Blush_20Rose_20257_ab825113-aa08-457b-bcc1-4c094d65627e.jpg?v=1652512942</image:loc>
      <image:title>Blush Rose Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Blush Rose Preciosa Hotfix Rhinestones (1621657911330)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-zircon-shimmer-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Blue_20Zircon_20Shimmer_20229_20971_5ad769fe-f48d-49f7-a5c0-643d5ecd8f02.jpg?v=1652512948</image:loc>
      <image:title>Blue Zircon Shimmer Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Blue Zircon Shimmer Preciosa Hotfix Rhinestones (1621657845794)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-zircon-satin-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Blue_20Zircon_20Satin_20229_20SAT_316fb8c1-3b52-4b32-a725-3931779ec9c4.jpg?v=1652512953</image:loc>
      <image:title>Blue Zircon Satin Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Blue Zircon Satin Preciosa Hotfix Rhinestones (1621657813026)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-zircon-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Blue_20Zircon_20229_d8b423be-33a8-49df-a171-22c8ed97efbc.jpg?v=1652512958</image:loc>
      <image:title>Blue Zircon Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Blue Zircon Preciosa Hotfix Rhinestones (1621657780258)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-diamond-shimmer-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Black_20Diamond_20Shimmer_202015_20971_8058b327-0b0a-40e9-b41f-f2567de96ff2.jpg?v=1652512964</image:loc>
      <image:title>Blue-Black Diamond Shimmer Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Black Diamond Shimmer Preciosa Hotfix Rhinestones (1621657714722)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-diamond-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Black_20Diamond_20215_8951b908-8142-44ce-b3b3-c68aaef3c9aa.jpg?v=1652512969</image:loc>
      <image:title>Black Diamond Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Black Diamond Preciosa Hotfix Rhinestones (1621657681954)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/aqua-marine-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Aquamarine_20202_442a2c08-b2f0-4a10-b060-199b9006a611.jpg?v=1652512975</image:loc>
      <image:title>Aqua Marine Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Aqua Marine Preciosa Hotfix Rhinestones (1621657649186)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/amethyst-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Amethyst_20204_0b62ef93-00f7-4e51-a345-fd1af28c4f08.jpg?v=1652512980</image:loc>
      <image:title>Amethyst Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Amethyst Preciosa Hotfix Rhinestones (1621657550882)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cosmojet-black-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/7_0d78eb52-fe65-4abb-bc9f-68285b586a6f.jpg?v=1652512986</image:loc>
      <image:title>Cosmojet Black Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Cosmojet Black Preciosa Hotfix Rhinestones (1581756776482)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/jet-black-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6-1_4882801c-420c-4f56-bdf5-7759a5258d2b.jpg?v=1652512992</image:loc>
      <image:title>Jet Black Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Jet Black Preciosa Hotfix Rhinestones (1581756743714)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-siam-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/5_fae27749-caf8-4a07-b83e-c5885461c6ce.jpg?v=1652512999</image:loc>
      <image:title>Light Siam Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Light Siam Preciosa Hotfix Rhinestones (1581756710946)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/hyacinth-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/4_826b76c4-0deb-4bc5-a440-88d71bf5eb6d.jpg?v=1652513005</image:loc>
      <image:title>Hyacinth Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Hyacinth Preciosa Hotfix Rhinestones (1581756678178)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-circular-drop-2-hole-glass-beads-16-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-14-12-53-23_product_1_1652513003883.jpg?v=1652513010</image:loc>
      <image:title>White Circular 2 Hole Glass Stones - 16 mm</image:title>
      <image:caption>white-circular-drop-2-hole-glass-beads-16-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/crysolite-opal-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/3_a1fa800f-3785-4eb7-b7b3-4445dcfc7cf7.jpg?v=1652513012</image:loc>
      <image:title>Crysolite Opal Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Crysolite Opal Preciosa Hotfix Rhinestones (1581756645410)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-crystal-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2-2_d2280834-8696-46a4-b9f9-2f4a18c650f6.jpg?v=1652513018</image:loc>
      <image:title>White / Crystal Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>White / Crystal Preciosa Hotfix Rhinestones (1581756612642)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/topaz-ab-preciosa-hotfix-rhinestones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1-1_f7ad3e7d-8e4b-421a-8c47-3a700230574a.jpg?v=1652513025</image:loc>
      <image:title>Topaz AB Preciosa Hotfix Flatback Rhinestone Crystal Rhinestones</image:title>
      <image:caption>Topaz AB Preciosa Hotfix Rhinestones (1581756579874)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-yellow-drop-2-hole-glass-beads-25x18-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-14-13-3-40_product_1_1652513620249.jpg?v=1746426994</image:loc>
      <image:title>Light Yellow Drop 2 Hole Glass Stones- 25x18 mm</image:title>
      <image:caption>light-yellow-drop-2-hole-glass-beads-25x18-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-circular-2-hole-glass-beads-12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-14-13-6-39_product_1_1652513799250.jpg?v=1652513805</image:loc>
      <image:title>Green Circular 2 Hole Glass Stones- 12 mm</image:title>
      <image:caption>green-circular-2-hole-glass-beads-12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-circular-2-hole-glass-beads-12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-14-13-8-5_product_1_1652513885350.jpg?v=1746427045</image:loc>
      <image:title>Yellow Circular 2 Hole Glass Stones- 12 mm</image:title>
      <image:caption>yellow-circular-2-hole-glass-beads-12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-peach-stone-metal-cup-chains-6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-16-21-10-16_product_1_1652715616070.jpg?v=1652715622</image:loc>
      <image:title>Light Peach Stone Metal Cup Chains- 6 ss</image:title>
      <image:caption>light-peach-stone-metal-cup-chains-6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-drop-meena-kundan-stones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-16-21-31-22_product_1_1652716882316.jpg?v=1652716890</image:loc>
      <image:title>Multicolor Drop Meena Kundan Stones</image:title>
      <image:caption>multicolor-drop-meena-kundan-stones</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-blue-tyre-machine-cut-glass-beads-6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-16-21-43-55_product_1_1652717635293.jpg?v=1652717648</image:loc>
      <image:title>Multicolor Blue Tyre Machine Cut Glass Crystal Beads- 6 mm</image:title>
      <image:caption>multicolor-blue-tyre-machine-cut-glass-beads-6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-machine-cut-glass-beads-4-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-16-21-41-34_product_1_1652717494558.jpg?v=1652717505</image:loc>
      <image:title>Multicolor Machine Cut Glass Crystal Beads- 4 mm</image:title>
      <image:caption>multicolor-machine-cut-glass-beads-4-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-orange-machine-cut-glass-beads-4-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-17-11-25-19_product_1_1652766919574.jpg?v=1652766926</image:loc>
      <image:title>Multicolor Orange Machine Cut Glass Crystal Beads- 4 mm</image:title>
      <image:caption>multicolor-orange-machine-cut-glass-beads-4-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-blue-machine-cut-glass-beads-6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-17-11-26-55_product_1_1652767015425.jpg?v=1652767023</image:loc>
      <image:title>Multicolor Blue Machine Cut Glass Crystal Beads- 6 mm</image:title>
      <image:caption>multicolor-blue-machine-cut-glass-beads-6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-red-machine-cut-glass-beads-8-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-17-11-28-33_product_1_1652767113515.jpg?v=1652767120</image:loc>
      <image:title>Multicolor Red Machine Cut Glass Crystal Beads- 8 mm</image:title>
      <image:caption>multicolor-red-machine-cut-glass-beads-8-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-golden-rainbow-machine-cut-glass-beads-8-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-17-11-30-2_product_1_1652767202831.jpg?v=1652767210</image:loc>
      <image:title>Multicolor Golden Rainbow Machine Cut Glass Crystal Beads- 8 mm</image:title>
      <image:caption>multicolor-golden-rainbow-machine-cut-glass-beads-8-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-pink-machine-cut-glass-beads-4-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-17-11-32-4_product_1_1652767324275.jpg?v=1652767330</image:loc>
      <image:title>Multicolor Pink Machine Cut Glass Crystal Beads- 4 mm</image:title>
      <image:caption>multicolor-pink-machine-cut-glass-beads-4-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/asssortedpackofgoldenbullionwirenakshi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/8ff2cf8eaf6cf346db8ccbb3233419e4.png?v=1652775556</image:loc>
      <image:title>Asssorted Pack of Golden Bullion Wire / Nakshi</image:title>
      <image:caption>asssortedpackofgoldenbullionwirenakshi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/asssortedpackofmulticolorbullionwirenakshi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1d57570d5f2b07ebb4ee951305791d36.png?v=1652775567</image:loc>
      <image:title>Asssorted Pack of Multi Color Bullion Wire / Nakshi</image:title>
      <image:caption>asssortedpackofmulticolorbullionwirenakshi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/assortedpackofgoldenmetallicwires</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/bf7a2c5e94f827998e9fe79ffb82a906.png?v=1652775578</image:loc>
      <image:title>Golden Assorted Pack of Metallic Dabka Wires</image:title>
      <image:caption>assortedpackofgoldenmetallicwires</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/scarletpinknakshibullionwire</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a0865f583d724624fa7981bfd70a1a07.png?v=1652775594</image:loc>
      <image:title>Scarlet Pink Nakshi / Bullion Wire</image:title>
      <image:caption>scarletpinknakshibullionwire</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fuchsiapinknakshibullionwire</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/e19305e1e255837235dca86a0583952d.png?v=1652775615</image:loc>
      <image:title>Fuchsia Pink Nakshi / Bullion Wire</image:title>
      <image:caption>fuchsiapinknakshibullionwire</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pompeianrednakshibullionwire</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a5418f2a6a2ac4f8b273fed6f8ffb6e9.png?v=1652775635</image:loc>
      <image:title>Pompeian Red Nakshi / Bullion Wire</image:title>
      <image:caption>pompeianrednakshibullionwire</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/soladitebluenakshibullionwire</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2e0294201a31fa82723bbfb6b138f60e.png?v=1652775656</image:loc>
      <image:title>Soladite Blue Nakshi / Bullion Wire</image:title>
      <image:caption>soladitebluenakshibullionwire</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/watergoldennakshibullionwire</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1d2a240c739f233c8877ba8231d9fc67.png?v=1652775676</image:loc>
      <image:title>Water Golden Nakshi / Bullion Wire</image:title>
      <image:caption>watergoldennakshibullionwire</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/darkredgoldennakshibullionwire</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cab6ccfe27dd1ad1b8826be0bc3dee32.png?v=1652775703</image:loc>
      <image:title>Dark Red Golden Nakshi / Bullion Wire</image:title>
      <image:caption>darkredgoldennakshibullionwire</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/asssortedpackof20colorsbullionwirenakshi</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/ca2b6f0b2132e289ad80449bcecec46f.png?v=1652775740</image:loc>
      <image:title>Asssorted Pack of 20 Colors Bullion Wire / Nakshi</image:title>
      <image:caption>asssortedpackof20colorsbullionwirenakshi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolorednakshibullionwire</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6310bdf310fc238a69b5e25c0f5ed874.png?v=1652775779</image:loc>
      <image:title>Multi Colored Nakshi / Bullion Wire</image:title>
      <image:caption>multicolorednakshibullionwire</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/browngoldennakshibullionwire</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cb981afa4bb954faa51e30bcfec9db65.png?v=1652775816</image:loc>
      <image:title>Brown Golden Nakshi / Bullion Wire</image:title>
      <image:caption>browngoldennakshibullionwire</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/honeygoldennakshibullionwire</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/37cb0fe0d7f3a33f687999b4bb5e8c54.png?v=1652775852</image:loc>
      <image:title>Honey Golden Nakshi / Bullion Wire</image:title>
      <image:caption>honeygoldennakshibullionwire</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blacknakshibullionwire</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/8b64e9e0c4acf53b4d9885c9dd026c44.png?v=1652775886</image:loc>
      <image:title>Black Nakshi / Bullion Wire</image:title>
      <image:caption>blacknakshibullionwire</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fuchsiaredcolourmukaishmetalstrips</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/f779dfa3ac8d0f7f4211dafe7e35748b.png?v=1751543358</image:loc>
      <image:title>Fuchsia Red Colour Mukaish / Metal Strips</image:title>
      <image:caption>fuchsiaredcolourmukaishmetalstrips</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/scarletredcolourmukaishmetalstrips</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/b6bdbe20b34e3dfcb3a43c2786e212bb.png?v=1751543359</image:loc>
      <image:title>Scarlet Red Colour Mukaish / Metal Strips</image:title>
      <image:caption>scarletredcolourmukaishmetalstrips</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/goldenfleececolourmukaishmetalstrips</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9bb34f6ddbc0cd2ab3eca79aa1095809.png?v=1751543360</image:loc>
      <image:title>Golden Fleece Colour Mukaish / Metal Strips</image:title>
      <image:caption>goldenfleececolourmukaishmetalstrips</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/goldenmukaishmetallicrollforhandembroidery</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/196496026b8e8bb8b9062623da56e1e0.png?v=1751543361</image:loc>
      <image:title>Golden Mukaish Metallic Roll For Hand Embroidery</image:title>
      <image:caption>goldenmukaishmetallicrollforhandembroidery</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silvercolorpatternembossedmetalthreadroll</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c4f1dd43f6604ef6661a751184aaa45d.png?v=1751543362</image:loc>
      <image:title>Silver Color Pattern Embossed Metal Thread Roll</image:title>
      <image:caption>silvercolorpatternembossedmetalthreadroll</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silvercolortriangepatternembossedmetalthreadroll</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9c86084e0d695438d05a2b18c2c1fcb4.png?v=1751543364</image:loc>
      <image:title>Silver Color Triange Pattern Embossed Metal Thread Roll</image:title>
      <image:caption>silvercolortriangepatternembossedmetalthreadroll</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/satinnylondori1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/e1e4569b90c043995dccd43b7ecdc55d.png?v=1652782690</image:loc>
      <image:title>Blue Satin Nylon Dori</image:title>
      <image:caption>satinnylondori1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/satinnylondori2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a688f1dae40f6cc36cca53b3b868a1d4.png?v=1652782716</image:loc>
      <image:title>Light Golden Satin Nylon Dori</image:title>
      <image:caption>satinnylondori2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/satinnylondori3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/4f314f651f7073aa00f2ad7bd117880f.png?v=1652782742</image:loc>
      <image:title>Peach Satin Nylon Dori</image:title>
      <image:caption>satinnylondori3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/satinnylondori4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/7bb59e0937e226c1dfa21da196b18842.png?v=1652782768</image:loc>
      <image:title>Light Golden Satin Nylon Dori</image:title>
      <image:caption>satinnylondori4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/satinnylondori5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/ff05b5d4bdec8679da84d06a79f4d29b.png?v=1652782793</image:loc>
      <image:title>Lemon Yellow Satin Nylon Dori</image:title>
      <image:caption>satinnylondori5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/satinnylondori6</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/bb8309b226ab768bd2155e3b78345939.png?v=1652782819</image:loc>
      <image:title>Cool Brown Satin Nylon Dori</image:title>
      <image:caption>satinnylondori6</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/satinnylondori7</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/f2c80dee08c7b4199e0fa2284b5ff7bf.png?v=1652782844</image:loc>
      <image:title>Navy Blue Satin Nylon Dori</image:title>
      <image:caption>satinnylondori7</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/satinnylondori9</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/eb3c27bc2357583db74dc315c1012499.png?v=1652782894</image:loc>
      <image:title>Red Orange Satin Nylon Dori</image:title>
      <image:caption>satinnylondori9</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/satinnylondori11</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/dcd69e9fae16cbf58ee500c6af6089f6.png?v=1652782946</image:loc>
      <image:title>Maroon Satin Nylon Dori</image:title>
      <image:caption>satinnylondori11</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/satinnylondori12</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/24fe0f4a477f39327b757308b540b274.png?v=1652782971</image:loc>
      <image:title>Baby Blue Satin Nylon Dori</image:title>
      <image:caption>satinnylondori12</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/satinnylondori13</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/f718781db0c3c005ab4f7400c0b05187.png?v=1652782996</image:loc>
      <image:title>Violet Satin Nylon Dori</image:title>
      <image:caption>satinnylondori13</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colourful-hanging-for-garment</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-17-15-57-2_product_1_1652783222922.jpg?v=1652783228</image:loc>
      <image:title>Red Hanging For Garments</image:title>
      <image:caption>colourful-hanging-for-garment</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colourful-hanging-for-garment-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-17-16-20-30_product_1_1652784630183.jpg?v=1652784638</image:loc>
      <image:title>Blue Coin Garment Hangings</image:title>
      <image:caption>colourful-hanging-for-garment-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colourful-hanging-for-garment-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-17-16-28-16_product_1_1652785096427.jpg?v=1652785103</image:loc>
      <image:title>Red Hanging for Garments</image:title>
      <image:caption>colourful-hanging-for-garment-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/hanging-for-garment</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-17-16-54-49_product_1_1652786689600.jpg?v=1652786696</image:loc>
      <image:title>Colourful Garment Hangings</image:title>
      <image:caption>hanging-for-garment</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/hanging-for-garment-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-17-16-57-21_product_1_1652786841981.jpg?v=1652786847</image:loc>
      <image:title>Red hanging for Garment</image:title>
      <image:caption>hanging-for-garment-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/goldencolourmukaishmetalstrips</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/04c17c808c53a0db3ad17f0072337f7d_af8aa5a5-0c3d-4b16-9574-179dde2427ef.png?v=1751543365</image:loc>
      <image:title>Golden Colour Mukaish / Metal Strips</image:title>
      <image:caption>goldencolourmukaishmetalstrips</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-flower-metal-embellishment</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-18-16-52-39_product_1_1652872959373.jpg?v=1652872967</image:loc>
      <image:title>Green Flower Metal Embellishment</image:title>
      <image:caption>green-flower-metal-embellishment</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/brown-pink-flower-metal-embellishment</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-18-16-53-58_product_1_1652873038454.jpg?v=1652873046</image:loc>
      <image:title>Brown Pink Flower Metal Embellishment</image:title>
      <image:caption>brown-pink-flower-metal-embellishment</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/brown-flower-metal-embellishment</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-18-16-55-34_product_1_1652873134430.jpg?v=1652873142</image:loc>
      <image:title>Brown Flower Metal Embellishment</image:title>
      <image:caption>brown-flower-metal-embellishment</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-flower-metal-embellishment</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-18-16-56-50_product_1_1652873210305.jpg?v=1652873218</image:loc>
      <image:title>Pink Flower Metal Embellishment</image:title>
      <image:caption>pink-flower-metal-embellishment</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/deep-pink-flower-metal-embellishment</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-18-16-58-6_product_1_1652873286844.jpg?v=1652873294</image:loc>
      <image:title>Deep Pink Flower Metal Embellishment</image:title>
      <image:caption>deep-pink-flower-metal-embellishment</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-blue-flower-metal-embellishment</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-18-16-59-40_product_1_1652873380898.jpg?v=1652873389</image:loc>
      <image:title>Light Blue Flower Metal Embellishment</image:title>
      <image:caption>light-blue-flower-metal-embellishment</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-flower-metal-embellishment</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-18-17-0-56_product_1_1652873456041.jpg?v=1652873463</image:loc>
      <image:title>Yellow Flower Metal Embellishment</image:title>
      <image:caption>yellow-flower-metal-embellishment</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-mauve-flower-metal-embellishment</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-18-17-2-15_product_1_1652873535267.jpg?v=1652873543</image:loc>
      <image:title>Light Mauve Flower Metal Embellishment</image:title>
      <image:caption>light-mauve-flower-metal-embellishment</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-uneven-plastic-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-18-17-5-45_product_1_1652873745239.jpg?v=1652873753</image:loc>
      <image:title>Blue Uneven Plastic Stones</image:title>
      <image:caption>blue-uneven-plastic-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/purple-grey-flower-plastic-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-18-17-7-51_product_1_1652873871349.jpg?v=1652873879</image:loc>
      <image:title>Purple Gray Flower Plastic Stones</image:title>
      <image:caption>purple-grey-flower-plastic-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/purple-uneven-plastic-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-18-17-11-49_product_1_1652874109007.jpg?v=1652874116</image:loc>
      <image:title>Purple Uneven Plastic Stones</image:title>
      <image:caption>purple-uneven-plastic-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-blue-ring-plastic-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-18-17-12-59_product_1_1652874179908.jpg?v=1652874187</image:loc>
      <image:title>Dark Blue Ring Plastic Stones</image:title>
      <image:caption>dark-blue-ring-plastic-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-ring-plastic-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-18-17-15-27_product_1_1652874327624.jpg?v=1652874335</image:loc>
      <image:title>Golden Ring Plastic Stones</image:title>
      <image:caption>golden-ring-plastic-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-brown-oval-2-hole-plastic-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-18-17-17-9_product_1_1652874429604.jpg?v=1652874437</image:loc>
      <image:title>Pink Brown Oval 2 Hole Plastic Beads</image:title>
      <image:caption>pink-brown-oval-2-hole-plastic-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-rectangular-2-hole-plastic-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-18-17-18-30_product_1_1652874510139.jpg?v=1652874518</image:loc>
      <image:title>Blue Rectangular 2 Hole Plastic Beads</image:title>
      <image:caption>blue-rectangular-2-hole-plastic-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-purple-oval-2-hole-plastic-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-18-17-19-55_product_1_1652874595196.jpg?v=1652874603</image:loc>
      <image:title>Dark Purple Oval 2 Hole Plastic Beads</image:title>
      <image:caption>dark-purple-oval-2-hole-plastic-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-rectangular-2-hole-plastic-beads-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-18-17-21-25_product_1_1652874685149.jpg?v=1652874692</image:loc>
      <image:title>Blue Rectangular 2 Hole Plastic Stones</image:title>
      <image:caption>blue-rectangular-2-hole-plastic-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dull-blue-rectangular-2-hole-plastic-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-18-17-26-58_product_1_1652875018129.jpg?v=1652875026</image:loc>
      <image:title>Dull Blue Rectangular 2 Hole Plastic Stones</image:title>
      <image:caption>dull-blue-rectangular-2-hole-plastic-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-square-plastic-beads-with-enamal-work</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-18-17-29-11_product_1_1652875151296.jpg?v=1652875158</image:loc>
      <image:title>Multicolour Square Plastic Stones With Enamel Work</image:title>
      <image:caption>multicolor-square-plastic-beads-with-enamal-work</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/beutiful-neck-piece-for-garments</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-18-18-25-44_product_1_1652878544785.jpg?v=1652878551</image:loc>
      <image:title>Multicolor Plastic Pieces</image:title>
      <image:caption>beutiful-neck-piece-for-garments</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/beautiful-neck-piece-for-girls-frock</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-18-18-28-21_product_1_1652878701196.jpg?v=1652878706</image:loc>
      <image:title>Multicolor Plastic Pieces</image:title>
      <image:caption>beautiful-neck-piece-for-girls-frock</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/oxford-blue-chambray</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-19-9-28-52_product_1_1652932732165.jpg?v=1747549890</image:loc>
      <image:title>Oxford Blue Plain Yarn Dyed Chambray Cotton Fabric</image:title>
      <image:caption>oxford-blue-chambray</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cotton-plaid-check-shirting-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/img_20241202_141648.jpg?v=1749302091</image:loc>
      <image:title>Beige Checks Yarn Dyed Plaid Cotton Fabric</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/chocolate-brown-plain-bangalore-raw-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-19-19-39-15_product_1_1652969355133.jpg?v=1756272927</image:loc>
      <image:title>Chocolate Brown Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>chocolate-brown-plain-bangalore-raw-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/honey-golden-plain-bangalore-raw-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/img_9730.jpg?v=1763184839</image:loc>
      <image:title>Honey Golden Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>honey-golden-plain-bangalore-raw-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/lilac-plain-bangalore-raw-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/img_9496_0450be28-1432-4e41-a675-806b4331b10d.jpg?v=1760542736</image:loc>
      <image:title>Lilac Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>lilac-plain-bangalore-raw-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-pink-plain-bangalore-raw-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-19-19-59-59_product_1_1652970599873.jpg?v=1756272923</image:loc>
      <image:title>Red Pink Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>red-pink-plain-bangalore-raw-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/orange-double-tone-designer-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/ebc6ca0f8070f3a1eaa64520920bd9e8_8d5ead8e-bdca-4bbe-9535-0b285671d284.jpg?v=1653042128</image:loc>
      <image:title>Orange Double Tone Designer Glass Beads</image:title>
      <image:caption>Orange Double Tone Designer Glass Beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/carameltwistedvariegatedzarimetallicthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/611b25136049d3fee4707b4f59729dbe.png?v=1653048577</image:loc>
      <image:title>Caramel Twisted Variegated Zari / Metallic Threads</image:title>
      <image:caption>carameltwistedvariegatedzarimetallicthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/greentwistedvariegatedzarimetallicthreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/931a492dc2a3ebf5f1732342d488080e.png?v=1653048614</image:loc>
      <image:title>Green Twisted Variegated Zari / Metallic Threads</image:title>
      <image:caption>greentwistedvariegatedzarimetallicthreads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/rubyredmetallicembroideryzarithread</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/89ceed1ad61ac1cedeba0bb7a844a479.png?v=1653049106</image:loc>
      <image:title>Ruby Red Metallic Embroidery Zari Thread Cone</image:title>
      <image:caption>rubyredmetallicembroideryzarithread</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/antiquesilvermetallicembroideryzarithread</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/28ce37a11d063f1ccb9d3f1cc67b185f.png?v=1653049181</image:loc>
      <image:title>Antique Silver Metallic Embroidery Zari Thread Cone</image:title>
      <image:caption>antiquesilvermetallicembroideryzarithread</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/graymetallicembroideryzarithread</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/f2dd27ba34c70451b200f6c86624f39c.png?v=1653049250</image:loc>
      <image:title>Gray Metallic Embroidery Zari Thread Cone</image:title>
      <image:caption>graymetallicembroideryzarithread</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/metalliczarithreadcombopack10colors</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/85db5290293f667b6e088e5d7d551f81.png?v=1653049283</image:loc>
      <image:title>Metallic Zari Thread Combo Pack- 10 Colors</image:title>
      <image:caption>metalliczarithreadcombopack10colors</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/bloodredzarithread</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a7baf5bd4a0df12cc9199ca5c6aeceee.png?v=1653049315</image:loc>
      <image:title>Blood Red Badla Zari Threads (Flat Metallic Yarn)</image:title>
      <image:caption>bloodredzarithread</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/antiquegoldenzarithread</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/fc2c6a6b4a0d78fca2b4bdff68aea321.png?v=1653049352</image:loc>
      <image:title>Antique Golden Badla Zari Threads (Flat Metallic Yarn)</image:title>
      <image:caption>antiquegoldenzarithread</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/darkyellowgoldenzarithread</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c02fa4780000ed1d6db8dff7107e6191.png?v=1653049393</image:loc>
      <image:title>Dark Yellow Golden Badla Zari Threads (Flat Metallic Yarn)</image:title>
      <image:caption>darkyellowgoldenzarithread</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/copperbronzezarithread</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/02a641cdc753383da95ff5e2f5164928.png?v=1653049433</image:loc>
      <image:title>Copper Bronze Badla Zari Threads (Flat Metallic Yarn)</image:title>
      <image:caption>copperbronzezarithread</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/lightgoldenzarithread</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/ab00ae9846f2881a179410cf6b14da10.png?v=1653049471</image:loc>
      <image:title>Light Golden Badla Zari Threads (Flat Metallic Yarn)</image:title>
      <image:caption>lightgoldenzarithread</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/darkgolden15mmmetalliccottonzarithread</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cbde101bb17b0d5fa23e175a9bc25061.png?v=1653049549</image:loc>
      <image:title>Dark Golden 1.5MM Metallic Cotton Zari Thread Cone</image:title>
      <image:caption>darkgolden15mmmetalliccottonzarithread</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/lightgolden15mmmetalliccottonzarithread</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/57098731f3aca4ca8f5f66ef3e176932.png?v=1653049668</image:loc>
      <image:title>Light Golden 1.5MM Metallic Cotton Zari Thread</image:title>
      <image:caption>lightgolden15mmmetalliccottonzarithread</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-plain-dyeable-organza-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-27-18-37-46_product_1_1653656866798.jpg?v=1753087881</image:loc>
      <image:title>White Plain Dyeable Organza Fabric</image:title>
      <image:caption>white-plain-dyeable-organza-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-plain-dyeable-viscose-organza-fabric-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-27-19-2-6_product_1_1653658326234.jpg?v=1775022470</image:loc>
      <image:title>White Plain Dyeable Viscose Organza Fabric</image:title>
      <image:caption>white-plain-dyeable-viscose-organza-fabric-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-blue-leaf-2-hole-plastic-stones-20x28-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-28-19-43-47_product_1_1653747227125.jpg?v=1653747235</image:loc>
      <image:title>Light Blue Leaf 2 Hole Plastic Stones- 20x28 mm</image:title>
      <image:caption>light-blue-leaf-2-hole-plastic-stones-20x28-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-blue-leaf-2-hole-plastic-stones-21x15-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-28-19-46-17_product_1_1653747377687.jpg?v=1653747386</image:loc>
      <image:title>Light Blue Oval 2 Hole Plastic Stones- 21x15 mm</image:title>
      <image:caption>light-blue-leaf-2-hole-plastic-stones-21x15-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/grey-oval-2-hole-plastic-stones-20x28-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-28-19-49-7_product_1_1653747547840.jpg?v=1653747555</image:loc>
      <image:title>Gray Oval 2 Hole Plastic Stones- 20x28 mm</image:title>
      <image:caption>grey-oval-2-hole-plastic-stones-20x28-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-purple-circular-ring-1-hole-plastic-stone-30-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-28-19-51-15_product_1_1653747675877.jpg?v=1653747683</image:loc>
      <image:title>Dark Purple Circular Ring 1 Hole Plastic Stone- 30 mm</image:title>
      <image:caption>dark-purple-circular-ring-1-hole-plastic-stone-30-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-flower-plastic-stone-25-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-28-19-53-19_product_1_1653747799936.jpg?v=1653747807</image:loc>
      <image:title>Yellow Flower Plastic Stone- 25 mm</image:title>
      <image:caption>yellow-flower-plastic-stone-25-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-blue-circular-ring-1-hole-plastic-stone-30-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-28-19-55-27_product_1_1653747927436.jpg?v=1653747935</image:loc>
      <image:title>Light Blue Circular Ring 1 Hole Plastic Stone- 30 mm</image:title>
      <image:caption>light-blue-circular-ring-1-hole-plastic-stone-30-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-half-round-glass-beads-4-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-28-19-58-38_product_1_1653748118652.jpg?v=1746384046</image:loc>
      <image:title>Silver Half Round Glass Beads- 4 mm</image:title>
      <image:caption>silver-half-round-glass-beads-4-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/purple-flower-plastic-stones-25-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-30-13-19-6_product_1_1653896946863.jpg?v=1653896952</image:loc>
      <image:title>Purple Flower Plastic Stones- 25 mm</image:title>
      <image:caption>purple-flower-plastic-stones-25-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-purple-flower-plastic-stones-25-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-30-13-20-55_product_1_1653897055012.jpg?v=1653897060</image:loc>
      <image:title>Light Purple Flower Plastic Stones- 25 mm</image:title>
      <image:caption>light-purple-flower-plastic-stones-25-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/purple-blue-drop-plastic-beads-25x35-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-31-20-45-31_product_1_1654010131776.jpg?v=1654010140</image:loc>
      <image:title>Purple Blue Drop Plastic Beads- 25x35 mm</image:title>
      <image:caption>purple-blue-drop-plastic-beads-25x35-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/navy-blue-drop-plastic-beads-25x35-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-31-20-47-14_product_1_1654010234455.jpg?v=1654010242</image:loc>
      <image:title>Navy Blue Drop Plastic Beads- 25x35 mm</image:title>
      <image:caption>navy-blue-drop-plastic-beads-25x35-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-drop-plastic-beads-25x35-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-5-31-20-48-44_product_1_1654010324657.jpg?v=1654010333</image:loc>
      <image:title>Yellow Drop Plastic Beads- 25x35 mm</image:title>
      <image:caption>yellow-drop-plastic-beads-25x35-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pre-cut-white-plain-voile-cotton-fabric-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2021-8-5-15-15-13_product_1_1628156713620_6a362adb-e459-4e28-8aed-d2753c22b76b.jpg?v=1753087880</image:loc>
      <image:title>White Plain Voile Pure Cotton Fabric</image:title>
      <image:caption>white-cotton-voile-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-gold-metal-glass-cup-chains</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-1-19-31-28_product_1_1654092088086.jpg?v=1654092096</image:loc>
      <image:title>Silver Gold Metal Glass 6 SS Cup Chains</image:title>
      <image:caption>silver-gold-metal-glass-cup-chains</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-metal-glass-cup-chains</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-1-19-32-43_product_1_1654092163442.jpg?v=1654092172</image:loc>
      <image:title>Silver Metal Glass Cup 6 SS Chains</image:title>
      <image:caption>silver-metal-glass-cup-chains</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/rose-pink-metal-glass-cup-chains</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-1-19-35-27_product_1_1654092327388.jpg?v=1654092336</image:loc>
      <image:title>Rose Pink Metal Glass 6 SS Cup Chains</image:title>
      <image:caption>rose-pink-metal-glass-cup-chains</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-white-abstract-tie-and-dye-pure-viscose-georgette-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-1-19-38-29_product_1_1654092509836.jpg?v=1754131642</image:loc>
      <image:title>Green White Abstract Tie and Dye Pure Viscose Georgette Fabric</image:title>
      <image:caption>green-white-abstract-tie-and-dye-pure-viscose-georgette-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/copper-drum-plastic-beads-with-stones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-2-18-41-27_product_1_1654175487435.jpg?v=1654175497</image:loc>
      <image:title>Copper Drum Plastic Beads With Stones</image:title>
      <image:caption>copper-drum-plastic-beads-with-stones</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-silver-circular-glass-beads-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-2-18-48-11_product_1_1654175891671.jpg?v=1746384061</image:loc>
      <image:title>Blue Silver Circular Glass Beads- 10 mm</image:title>
      <image:caption>blue-silver-circular-glass-beads-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-silver-circular-glass-beads-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-2-18-49-38_product_1_1654175978514.jpg?v=1746384108</image:loc>
      <image:title>Green Silver Circular Glass Beads- 10 mm</image:title>
      <image:caption>green-silver-circular-glass-beads-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/brown-silver-circular-glass-beads-12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-2-18-54-13_product_1_1654176253259.jpg?v=1746425308</image:loc>
      <image:title>Brown Silver Circular Glass Beads- 12 mm</image:title>
      <image:caption>brown-silver-circular-glass-beads-12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-silver-drop-glass-beads-10x13-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-2-18-58-51_product_1_1654176531197.jpg?v=1746384150</image:loc>
      <image:title>Green Silver Drop Glass Beads- 10x13 mm</image:title>
      <image:caption>green-silver-drop-glass-beads-10x13-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-blue-silver-oval-glass-beads-9x17-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-2-19-4-41_product_1_1654176881765.jpg?v=1746425341</image:loc>
      <image:title>Light Blue Silver Oval Glass Beads- 9x17 mm</image:title>
      <image:caption>light-blue-silver-oval-glass-beads-9x17-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-silver-oval-glass-beads-9x17-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-2-19-7-17_product_1_1654177037089.jpg?v=1746425665</image:loc>
      <image:title>Green Silver Oval Glass Beads- 9x17 mm</image:title>
      <image:caption>green-silver-oval-glass-beads-9x17-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-pink-silver-oval-glass-beads-10x13-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-2-19-20-39_product_1_1654177839778.jpg?v=1746426456</image:loc>
      <image:title>Light Pink Silver Oval Glass Beads- 10x13 mm</image:title>
      <image:caption>light-pink-silver-oval-glass-beads-10x13-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-silver-oval-glass-beads-10x13-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-2-19-22-5_product_1_1654177925099.jpg?v=1746425972</image:loc>
      <image:title>Black Silver Oval Glass Beads- 10x13 mm</image:title>
      <image:caption>black-silver-oval-glass-beads-10x13-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-assorted-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-2-19-26-38_product_1_1654178198778.jpg?v=1746426692</image:loc>
      <image:title>Multicolor Assorted Glass Beads</image:title>
      <image:caption>multicolor-assorted-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/reddish-plain-6-ply-yarn-dyed-handloom-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-3-13-37-32_product_2_1654243652048.jpg?v=1671431548</image:loc>
      <image:title>Light Red Plain 6 Ply Yarn Dyed Handloom Cotton Fabric</image:title>
      <image:caption>reddish-plain-6-ply-yarn-dyed-handloom-cotton-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/beige-colour-plain-self-handloom-jharna-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-3-13-45-1_product_2_1654244101215.jpg?v=1671431357</image:loc>
      <image:title>Beige Plain Self Handloom Jharna Cotton Fabric</image:title>
      <image:caption>beige-colour-plain-self-handloom-jharna-cotton-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-hotfix-stones</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/KACS86_1dd07fae-cf0d-434d-8ddf-87f82256a18d.jpg?v=1654346921</image:loc>
      <image:title>White Hotfix Stones</image:title>
      <image:caption>white-hotfix-stones-kacs86_cs</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-water-golden-double-thread-work-designer-embroidered-lace</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/3C_46342a8e-a949-4f98-8670-7ce7e1ec9c4b.png?v=1743576483</image:loc>
      <image:title>Light Water Golden Double Thread Work Designer Embroidered Lace</image:title>
      <image:caption>light-water-golden-double-thread-work-designer-embroidered-lace</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/sea-green-plain-bangalore-raw-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/img_9800.jpg?v=1756272918</image:loc>
      <image:title>Sea Green Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>sea-green-plain-bangalore-raw-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-color-stone-studded-deer-designer-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-7-23-25-35_product_1_1654678535793.jpg?v=1654624517</image:loc>
      <image:title>Golden Color Stone Studded Deer Designer Brooch</image:title>
      <image:caption>golden-color-stone-studded-deer-designer-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-circular-glass-beads-8-0</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-8-20-12-2_product_1_1654699322198.jpg?v=1746427135</image:loc>
      <image:title>Multicolor Circular Glass Beads- 8/0</image:title>
      <image:caption>multicolor-circular-glass-beads-8-0</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-red-oval-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-8-20-14-0_product_1_1654699440166.jpg?v=1746426769</image:loc>
      <image:title>Dark Red Oval Glass Beads</image:title>
      <image:caption>dark-red-oval-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/orange-drop-oval-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-8-20-21-52_product_1_1654699912453.jpg?v=1746426979</image:loc>
      <image:title>Orange Drop Glass Beads</image:title>
      <image:caption>orange-drop-oval-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-color-stylish-deer-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-9-9-37-49_product_1_1654801669374.jpg?v=1654747663</image:loc>
      <image:title>Golden Color Stylish Deer Brooch</image:title>
      <image:caption>golden-color-stylish-deer-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-color-beautiful-tiger-designer-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-9-9-44-59_product_1_1654802099664.jpg?v=1654748081</image:loc>
      <image:title>Golden Color Beautiful Tiger Designer Brooch</image:title>
      <image:caption>golden-color-beautiful-tiger-designer-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-black-stylish-snake-designer-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-9-9-54-16_product_1_1654802656234.jpg?v=1654748652</image:loc>
      <image:title>Golden Black Stylish Snake Designer Brooch</image:title>
      <image:caption>golden-black-stylish-snake-designer-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-drop-plastic-stone-with-catcher-14x10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-10-21-16-59_product_1_1654876019526.jpg?v=1654876024</image:loc>
      <image:title>Multicolour Drop Plastic Stone With Catcher- 14x10 mm</image:title>
      <image:caption>multicolor-drop-plastic-stone-with-catcher-14x10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-circular-plastic-stone-with-catcher-12-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-10-21-20-17_product_1_1654876217748.jpg?v=1654876222</image:loc>
      <image:title>Multicolour Circular Plastic Stone With Catcher- 12 mm</image:title>
      <image:caption>multicolor-circular-plastic-stone-with-catcher-12-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-assorted-circular-plastic-stone-with-catcher</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-10-21-22-19_product_1_1654876339216.jpg?v=1654876344</image:loc>
      <image:title>Multicolour Assorted Circular Plastic Stone With Catcher</image:title>
      <image:caption>multicolor-assorted-circular-plastic-stone-with-catcher</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-drop-plastic-stone-with-catcher-18x13-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-10-21-24-6_product_1_1654876446149.jpg?v=1654876451</image:loc>
      <image:title>Multicolour Drop Plastic Stone With Catcher- 18x13 mm</image:title>
      <image:caption>multicolor-drop-plastic-stone-with-catcher-18x13-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-eye-plastic-stone-with-catcher-15x7-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-10-21-26-35_product_1_1654876595732.jpg?v=1654876601</image:loc>
      <image:title>Multicolor Eye Plastic Stone With Catcher- 15x7 mm</image:title>
      <image:caption>multicolor-eye-plastic-stone-with-catcher-15x7-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-circular-plastic-stone-with-catcher-8-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-10-21-30-18_product_1_1654876818918.jpg?v=1654876824</image:loc>
      <image:title>Multicolor Circular Plastic Stone With Catcher- 8 mm</image:title>
      <image:caption>multicolor-circular-plastic-stone-with-catcher-8-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-opal-drop-plastic-stone-with-catcher-18x13-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-11-19-19-14_product_1_1654955354360.jpg?v=1654955362</image:loc>
      <image:title>Multicolor Opal Drop Plastic Stone With Catcher- 18x13 mm</image:title>
      <image:caption>multicolor-opal-drop-plastic-stone-with-catcher-18x13-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-opal-oval-plastic-stone-with-catcher-18x13-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-11-19-21-3_product_1_1654955463345.jpg?v=1654955471</image:loc>
      <image:title>Multicolor Opal Oval Plastic Stone With Catcher- 18x13 mm</image:title>
      <image:caption>multicolor-opal-oval-plastic-stone-with-catcher-18x13-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-drop-plastic-stone-with-catcher-18x13-mm-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-11-19-24-48_product_1_1654955688562.jpg?v=1654955697</image:loc>
      <image:title>Multicolor Drop Plastic Stone With Catcher- 18x13 mm</image:title>
      <image:caption>multicolor-drop-plastic-stone-with-catcher-18x13-mm-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-circular-plastic-stone-with-catcher-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-11-19-29-8_product_1_1654955948047.jpg?v=1654955956</image:loc>
      <image:title>Multicolor Circular Plastic Stone With Catcher- 10 mm</image:title>
      <image:caption>multicolor-circular-plastic-stone-with-catcher-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-silver-opal-plastic-stone-with-catcher-10x10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-11-19-32-10_product_1_1654956130307.jpg?v=1654956138</image:loc>
      <image:title>White Silver Opal Plastic Stone With Catcher- 10x10 mm</image:title>
      <image:caption>white-silver-opal-plastic-stone-with-catcher-10x10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-opal-plastic-stone-with-catcher-18x13-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-12-11-43-47_product_1_1655014427311.jpg?v=1655014434</image:loc>
      <image:title>Multicolor Opal Plastic Stone With Catcher- 18x13 mm</image:title>
      <image:caption>multicolor-opal-plastic-stone-with-catcher-18x13-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-opal-plastic-stone-with-catcher-6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-6-12-11-46-9_product_1_1655014569659.jpg?v=1655014575</image:loc>
      <image:title>Multicolor Opal Plastic Stone With Catcher- 6 mm</image:title>
      <image:caption>multicolor-opal-plastic-stone-with-catcher-6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/palegoldenflatmetallicbadlathread</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9d5a9726d38faffbb14a8b435f42dbbf.png?v=1655122072</image:loc>
      <image:title>Pale Golden Flat Metallic Badla Zari Threads (Flat Metallic Yarn)</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellowgoldenflatmetallicbadlathread</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/23342d39ceb0e6618549147f907e4fa6.png?v=1655122097</image:loc>
      <image:title>Yellow Golden Flat Metallic Badla Zari Threads (Flat Metallic Yarn)</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/metallicbraidedzarithreadscombo</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/affccbe66e30ce790ac04b5d5bd27fe5.png?v=1655127141</image:loc>
      <image:title>Metallic Braided Zari Threads Combo</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silverglittercorddori</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/495b81a0f0f9ccde3ae81ca32d97db8e.png?v=1655127168</image:loc>
      <image:title>Silver Glitter Cord Dori</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/oliveglittercorddori</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/4fd333f92caa702ae64f14700565ac68.png?v=1655127189</image:loc>
      <image:title>Olive Glitter Cord Dori</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/goldenglittercorddori</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/dd5d25a103bbb781b4e3d91af299eb7c.png?v=1655127211</image:loc>
      <image:title>Golden Glitter Cord Dori</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/darkmagentaglittercorddori</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/fc73bd7d4705fcf3d722bf1b348fcc54.png?v=1655127234</image:loc>
      <image:title>Dark Magenta Glitter Cord Dori</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blackmagentaglittercorddori</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1b8a2adfcd6945427a5fdb06b20d0442.png?v=1655127259</image:loc>
      <image:title>Black Magenta Glitter Cord Dori</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellowgoldenmetallicbraidedzarithreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a3a0985d0639ee5cae428f7f82ec2d68.png?v=1655127286</image:loc>
      <image:title>Yellow Golden Metallic Braided Zari Threads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/rosegoldmetallicbraidedzarithreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/5cc11b2cb1970ea8a7cfc1344ea560e2.png?v=1655127307</image:loc>
      <image:title>Rose Gold Metallic Braided Zari Threads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/lightcoppermetallicbraidedzarithreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/91ec066ea17b580401bdff3a559a144e.png?v=1655127329</image:loc>
      <image:title>Light Copper Metallic Braided Zari Threads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellowgoldmetallicbraidedzarithreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/63f90e85f768ee735f7407b137e6c1c9.png?v=1655127351</image:loc>
      <image:title>Yellow Gold Metallic Braided Zari Threads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/goldenmetallicbraidedzarithreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a4f61c537c60c31eeaa3bffaa78adb58.png?v=1655127372</image:loc>
      <image:title>Golden Metallic Braided Zari Threads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/brightbluemetallicbraidedzarithreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/68232bff3bbcff44aac14e5c269bd0d0.png?v=1655127394</image:loc>
      <image:title>Bright Blue Metallic Braided Zari Threads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silvermetallicbraidedzarithreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/4a3e486686d3d809ae780901840b5986.png?v=1655127416</image:loc>
      <image:title>Silver Metallic Braided Zari Threads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/redmetallicbraidedzarithreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/880b6ff9ff24c55b7c137fb4ac7ded7c.png?v=1655127438</image:loc>
      <image:title>Red Metallic Braided Zari Threads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/graymetallicbraidedzarithreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/48f08015d85f1efdb1ad94af2bb4848e.png?v=1655127461</image:loc>
      <image:title>Gray Metallic Braided Zari Threads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/lightgoldmetallicbraidedzarithreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/50a6574a297310521f0d2b4aab100f67.png?v=1655127483</image:loc>
      <image:title>Light Gold Metallic Braided Zari Threads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/whiterainbowmetallicbraidedzarithreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/f2970beb0c34db04cfee2f1bde151533.png?v=1655127510</image:loc>
      <image:title>White Rainbow Metallic Braided Zari Threads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blackmetallicbraidedzarithreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9b62ddeb9db6f555e95d4ece38670b1e.png?v=1655127564</image:loc>
      <image:title>Black Metallic Braided Zari Threads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/darkbluemetallicbraidedzarithreads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6fc7057fb5b7a94b68dc9a12d18a15f6.png?v=1655127588</image:loc>
      <image:title>Dark Blue Metallic Braided Zari Threads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/copper-gold-cone-metallic-yarn-discounted</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/MBZA000025_58ebb8a7-afae-4fd3-beaf-9b580770b7bf.jpg?v=1655375276</image:loc>
      <image:title>Copper Gold Zari Thread Cone (Metallic Yarn)</image:title>
      <image:caption>copper-gold-cone</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-gold-cone-metallic-yarn-discounted</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/MBZA000001_13e76054-2304-4fe2-8038-9f25005de051.jpg?v=1655375351</image:loc>
      <image:title>Light Gold Zari Thread Cone (Metallic Yarn Discounted)</image:title>
      <image:caption>light-gold-cone</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/deep-gold-cone-metallic-yarn-discounted</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/MBZA000013_84a34439-5f27-4677-8f3a-560705bbf073.jpg?v=1655375394</image:loc>
      <image:title>Deep Gold Zari Thread Cone (Metallic Yarn Discounted)</image:title>
      <image:caption>deep-gold-cone</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-rose-gold-cone-metallic-yarn-discounted</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/MBZA000007_bcc72aa6-baf0-4286-b18a-b4026d4f1aa6.jpg?v=1655375423</image:loc>
      <image:title>Light Rose Gold Zari Thread Cone (Metallic Yarn Discounted)</image:title>
      <image:caption>light-rose-gold-cone</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/assortedhexagonalacrylicbeads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/f43aafa222eb99d787c1ef2bb0884e35_d9752a4a-77fc-4106-a2ad-0fa958f642f3.png?v=1655467523</image:loc>
      <image:title>Multicolour Assorted Hexagonal Acrylic Beads</image:title>
      <image:caption>assortedhexagonalacrylicbeads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/transparentelasticbeadingwire</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/0bf9eb0dcaed62277b78d47087dd0ace_d21e32ae-6bbe-4d0d-846e-bc7344b14349.png?v=1655468946</image:loc>
      <image:title>White Transparent Elastic Beading Wire</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cartoonnamemdfboardcutpieces1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/941afc8460e85e5c235bc7dd13cfdb8a.png?v=1655465905</image:loc>
      <image:title>Blue Superman Designer MDF Wooden Embellishment</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cartoonnamemdfboardcutpieces2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/37f4e07e83a4b3fb265ad8dcc531a9d4.png?v=1655465943</image:loc>
      <image:title>Yellow Minions Designer MDF Wooden Embellishment</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cartoonnamemdfboardcutpieces3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d79f36a2604c13c12814cafd78938f65.png?v=1655465979</image:loc>
      <image:title>Blue Captain America Designer MDF Wooden Embellishment</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cartoonnamemdfboardcutpieces4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6bc01cd94740d26ca5492a84d2f05160.png?v=1655466014</image:loc>
      <image:title>Black Panda Designer MDF Wooden Embellishment</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cartoonnamemdfboardcutpieces5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/17a95b43df5dcb6d5d4599dff259e2e7.png?v=1655466078</image:loc>
      <image:title>Multicolour Fancy MDF Wooden Embellishment</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cartoonnamemdfboardcutpieces6</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/3a59850a4896eccaff563eea4bc76b05.png?v=1655466110</image:loc>
      <image:title>Multicolour Designer MDF Wooden Embellishment</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorshapeplasticsequins1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/8ac970fad2f0e79fe4a1f39cfa14386f.png?v=1655466145</image:loc>
      <image:title>Yellow Circular 2 Hole Plastic Sequins</image:title>
      <image:caption>Yellow Circular 2 Hole Plastic Sequins</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorshapeplasticsequins2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d6a113138fc3a0f88bc40fb97cec1471.png?v=1655466178</image:loc>
      <image:title>Metallic Blue Circular 2 Hole Plastic Sequins</image:title>
      <image:caption>Metallic Blue Circular 2 Hole Plastic Sequins</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorshapeplasticsequins3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/eae1c76b429615b4b174f3164ffa5c9d.png?v=1655466213</image:loc>
      <image:title>Green Circular 2 Hole Plastic Sequins</image:title>
      <image:caption>Green Circular 2 Hole Plastic Sequins</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorshapeplasticsequins5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/0fed4757ceba8aed2d083baf4da67b41.png?v=1655466285</image:loc>
      <image:title>Red Circular 2 Hole Plastic Sequins</image:title>
      <image:caption>Red Circular 2 Hole Plastic Sequins</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorshapeplasticsequins6</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/aca83bd94415e71ae9074f0d080b7427.png?v=1655466349</image:loc>
      <image:title>Baby Pink Circular 2 Hole Plastic Sequins</image:title>
      <image:caption>Baby Pink Circular 2 Hole Plastic Sequins</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorshapeplasticsequins7</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/5b150b153bb3757d4ee4356327c437f2.png?v=1655466383</image:loc>
      <image:title>Light Yellow Circular 2 Hole Plastic Sequins</image:title>
      <image:caption>Light Yellow Circular 2 Hole Plastic Sequins</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorirregularelongatedacrylicbeads2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/32b37b71322dc428034588cf1c58881a.png?v=1655466485</image:loc>
      <image:title>Light Orange Irregular Elongated Acrylic Beads</image:title>
      <image:caption>colorirregularelongatedacrylicbeads2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorirregularelongatedacrylicbeads3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2ef57e2686481c1dbb0ae8c00f70ae41.png?v=1655466521</image:loc>
      <image:title>Dark Green Irregular Elongated Acrylic Beads</image:title>
      <image:caption>colorirregularelongatedacrylicbeads3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorirregularelongatedacrylicbeads4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/e6697ede8f587c75b5037ad951165209.png?v=1655466585</image:loc>
      <image:title>Dark Blue Irregular Elongated Acrylic Beads</image:title>
      <image:caption>colorirregularelongatedacrylicbeads4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorcircularacrylicbeads1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/867a50aa0cd9b8fee5564b641e99cae1.png?v=1655466690</image:loc>
      <image:title>Light Green Circular Acrylic Beads</image:title>
      <image:caption>colorcircularacrylicbeads1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorcircularacrylicbeads2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/3986f415f7a7c7a31583e1fb1cf3a8a2.png?v=1655466724</image:loc>
      <image:title>Light Pink Circular Acrylic Beads</image:title>
      <image:caption>colorcircularacrylicbeads2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorcircularacrylicbeads3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/8b631f25774f1145137a9b03f7209ee6.png?v=1655466755</image:loc>
      <image:title>Light Purple Circular Acrylic Beads</image:title>
      <image:caption>colorcircularacrylicbeads3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorcircularacrylicbeads4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/49365fbaf26105e2310e7bc05eb39b85.png?v=1655466783</image:loc>
      <image:title>Orange Circular Acrylic Beads</image:title>
      <image:caption>colorcircularacrylicbeads4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorcircularacrylicbeads5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/ad8bc5548b9447d913e420f8bf21bb7d.png?v=1655466845</image:loc>
      <image:title>Light Yellow Circular Acrylic Beads</image:title>
      <image:caption>colorcircularacrylicbeads5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorhexaacrylicbeads1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2112d5cf367bf30c225d87f1be29b850.png?v=1655466890</image:loc>
      <image:title>Dark Blue Octagonal Acrylic Beads</image:title>
      <image:caption>colorhexaacrylicbeads1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorhexaacrylicbeads2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c46a7bc08e4e3fa52d4bd79c60ebe713.png?v=1655466940</image:loc>
      <image:title>Dark Red Octagonal Acrylic Beads</image:title>
      <image:caption>colorhexaacrylicbeads2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorhexaacrylicbeads3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/e5b1454712616fc32a7879e4a69182dc.png?v=1655466973</image:loc>
      <image:title>Light Pink Octagonal Acrylic Beads</image:title>
      <image:caption>colorhexaacrylicbeads3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorhexaacrylicbeads4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cb8958f0836032ee4a101ef823c500da.png?v=1655467008</image:loc>
      <image:title>Blue Octagonal Acrylic Beads</image:title>
      <image:caption>colorhexaacrylicbeads4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorhexaacrylicbeads5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1b911958ac0cb1ef6319a013e209e946.png?v=1655467043</image:loc>
      <image:title>Dark Pink Octagonal Acrylic Beads</image:title>
      <image:caption>colorhexaacrylicbeads5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorhexaacrylicbeads6</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/31142ec80bf09c36ff694fda532c4cb1.png?v=1655467081</image:loc>
      <image:title>Dark Green Octagonal Acrylic Beads</image:title>
      <image:caption>colorhexaacrylicbeads6</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colortopholeacrylicbeads1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cdc33aaaee05a4cf77208c7dc78e88d8.png?v=1655467152</image:loc>
      <image:title>Light Pink Flat Circular Top Hole Acrylic Beads</image:title>
      <image:caption>colortopholeacrylicbeads1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colortopholeacrylicbeads2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/57c60a2dd28a5bfca30fea81ad47abe2.png?v=1655467185</image:loc>
      <image:title>Mint Green Flat Circular Top Hole Acrylic Beads</image:title>
      <image:caption>colortopholeacrylicbeads2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colortopholeacrylicbeads3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/b2988d82e5cd7627575d90e491ab8077.png?v=1655467222</image:loc>
      <image:title>Light Purple Flat Circular Top Hole Acrylic Beads</image:title>
      <image:caption>colortopholeacrylicbeads3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colortopholeacrylicbeads4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/8eee1eaf600a332f1dd13a03595620c6.png?v=1655467252</image:loc>
      <image:title>Light Blue Flat Circular Top Hole Acrylic Beads</image:title>
      <image:caption>colortopholeacrylicbeads4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colortopholeacrylicbeads6</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6b8aa4920d152c36cbf80c54dfc7fc51.png?v=1655467309</image:loc>
      <image:title>Yellow Flat Circular Top Hole Acrylic Beads</image:title>
      <image:caption>colortopholeacrylicbeads6</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorpastelovalacrylicbeads1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/24aecbc6b3b0cdfbba7354b648c178f6.png?v=1655467994</image:loc>
      <image:title>Pastel Purple Oval Acrylic Beads</image:title>
      <image:caption>colorpastelovalacrylicbeads1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorpastelovalacrylicbeads2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d24570c61234489ce019997befce4e74.png?v=1655468028</image:loc>
      <image:title>Pastel Pink Oval Acrylic Beads</image:title>
      <image:caption>colorpastelovalacrylicbeads2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorpastelovalacrylicbeads3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/898b77e000713d9a15f52a0eeaf43982.png?v=1655468091</image:loc>
      <image:title>Pastel Cream Oval Acrylic Beads</image:title>
      <image:caption>colorpastelovalacrylicbeads3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorpastelovalacrylicbeads4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d61b63b2468c3bd0fa128d78c20b48cc.png?v=1655468124</image:loc>
      <image:title>Pastel Orange Oval Acrylic Beads</image:title>
      <image:caption>colorpastelovalacrylicbeads4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorpastelovalacrylicbeads5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/4ccca43cd048ad7c5aad199134c53978.png?v=1655468159</image:loc>
      <image:title>Pastel Green Oval Acrylic Beads</image:title>
      <image:caption>colorpastelovalacrylicbeads5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorpastelovalacrylicbeads6</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d0b4d3d0f04d6d27bd2718c4963e25a3.png?v=1655468193</image:loc>
      <image:title>Orange Oval Acrylic Beads</image:title>
      <image:caption>colorpastelovalacrylicbeads6</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorpasteloblongacrylicbeads1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/75239cef43595bf813a4b0bfc21fa30b.png?v=1655467778</image:loc>
      <image:title>Cream Oblong Acrylic Beads</image:title>
      <image:caption>colorpasteloblongacrylicbeads1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorpasteloblongacrylicbeads2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/e2e8af708d2c1e72960f2da081e14bb0.png?v=1655467813</image:loc>
      <image:title>Pastel Green Oblong Acrylic Beads</image:title>
      <image:caption>colorpasteloblongacrylicbeads2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorpasteloblongacrylicbeads4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/77583ecb41d725f02b086903f613ca6d.png?v=1655467908</image:loc>
      <image:title>Light Cream Oblong Acrylic Beads</image:title>
      <image:caption>colorpasteloblongacrylicbeads4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorpasteloblongacrylicbeads5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6bbdf9c27965322c42f310774eb0f982.png?v=1655467939</image:loc>
      <image:title>Purple Oblong Acrylic Beads</image:title>
      <image:caption>colorpasteloblongacrylicbeads5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorpasteloblongacrylicbeads6</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/11c143c9854fa443d91703b0385ba9f3.png?v=1655467966</image:loc>
      <image:title>Pink Oblong Acrylic Beads</image:title>
      <image:caption>colorpasteloblongacrylicbeads6</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorflowerdesignacrylicbeads2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6e6e624f7acf0d26f807072174c1f01c.png?v=1655468253</image:loc>
      <image:title>Pink Flower Designer Acrylic Beads</image:title>
      <image:caption>colorflowerdesignacrylicbeads2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colormonalisahydrocrystalbeads1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/974eab6de3f8afe9d4c591088920574e.png?v=1750929048</image:loc>
      <image:title>Light Blue Monalisa Hydro Crystal Beads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colormonalisahydrocrystalbeads2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/ff60667705d4ee3c6b6695c9b65fc1d1.png?v=1750929046</image:loc>
      <image:title>Light Pink Monalisa Hydro Crystal Beads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colormonalisahydrocrystalbeads3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/406085d38dd36dc005d8771c1db023fc.png?v=1750929045</image:loc>
      <image:title>Mint Green Monalisa Hydro Crystal Beads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colormonalisahydrocrystalbeads4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/0d6de331ef79e6d8133718b9553010be.png?v=1750929043</image:loc>
      <image:title>Yellow Monalisa Hydro Crystal Beads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colormonalisahydrocrystalbeads5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/acc11efe8a5f7c56f1d9e2c2c35a9554.png?v=1750929042</image:loc>
      <image:title>Pastel Blue Monalisa Hydro Crystal Beads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colormonalisahydrocrystalbeads6</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/db7b9c5b797c63446969d6aad77bd137.png?v=1750929040</image:loc>
      <image:title>Peach Pink Monalisa Hydro Crystal Beads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colormonalisahydrocrystalbeads7</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/546dd26c336ea16ad6699b6c428165d7.png?v=1750929039</image:loc>
      <image:title>Pastel Pink Monalisa Hydro Crystal Beads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colormonalisahydrocrystalbeads8</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/dde0b343824327d16cc49da761457314.png?v=1750929038</image:loc>
      <image:title>Purple Monalisa Hydro Crystal Beads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colormonalisahydrocrystalbeads9</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c618ba8023e977bb7cb13fd5651a16b9.png?v=1750929036</image:loc>
      <image:title>Aqua Blue Monalisa Hydro Crystal Beads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colormonalisahydrocrystalbeads10</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/440dd0580e81272b3b1c5033ff45c783.png?v=1750929035</image:loc>
      <image:title>Lavender Purple Monalisa Hydro Crystal Beads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colormonalisahydrocrystalbeads11</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/78dcf4efcd4edf404bb7833aee5251ed.png?v=1750929033</image:loc>
      <image:title>White Monalisa Hydro Crystal Beads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colormonalisahydrocrystalbeads12</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c50e80ff25ed67a26032d2acca34f145.png?v=1750929032</image:loc>
      <image:title>Green Monalisa Hydro Crystal Beads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colortransparentsphericalcrystalbeads3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/228a8bf2be87d6390da0e2ddf099fcf8.png?v=1750929030</image:loc>
      <image:title>Yellow Transparent Spherical Crystal Beads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colordesignmetalliccharms3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/ed8191dc94077fa3dc73f5189ddb941c.png?v=1655469518</image:loc>
      <image:title>White Panda Designer Metal Charms</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colordesignmetalliccharms4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1c97fcddb9b2a3a1f6d49ae8c0056b98.png?v=1655469393</image:loc>
      <image:title>Golden Square Designer Metal Charms</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorshapejaipuridesignerglassbeads1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/97f92ef75551f27592294afe07b5442e.png?v=1655469690</image:loc>
      <image:title>Blue White Designer Jaipuri Designer Glass Beads</image:title>
      <image:caption>colorshapejaipuridesignerglassbeads1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorshapejaipuridesignerglassbeads2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/623fbde5d73e76c60fd2b4f544152cea.png?v=1655469754</image:loc>
      <image:title>Red Designer Jaipuri Designer Glass Beads</image:title>
      <image:caption>colorshapejaipuridesignerglassbeads2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorshapejaipuridesignerglassbeads3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a4cf13acabee238a2d96762ffda63baf.png?v=1655469781</image:loc>
      <image:title>Yellow Black Designer Jaipuri Designer Glass Beads</image:title>
      <image:caption>colorshapejaipuridesignerglassbeads3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorshapejaipuridesignerglassbeads5</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/715b2077e496385971c9715afddd96ab.png?v=1655469841</image:loc>
      <image:title>Dark Green Jaipuri Designer Glass Beads</image:title>
      <image:caption>colorshapejaipuridesignerglassbeads5</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorshapejaipuridesignerglassbeads8</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/745f75978a7e1415e3b76478c102c47a.png?v=1655469968</image:loc>
      <image:title>Yellow Cylindrical Jaipuri Designer Glass Beads</image:title>
      <image:caption>colorshapejaipuridesignerglassbeads8</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorshapejaipuridesignerglassbeads9</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1aa92997358840a2ccfa930475749478.png?v=1655469997</image:loc>
      <image:title>Black Cylindrical Jaipuri Designer Glass Beads</image:title>
      <image:caption>colorshapejaipuridesignerglassbeads9</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorshapejaipuridesignerglassbeads10</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/f16fca9664bce0c93aab32313c52ea00.png?v=1655470027</image:loc>
      <image:title>Red Cylindrical Jaipuri Designer Glass Beads</image:title>
      <image:caption>colorshapejaipuridesignerglassbeads10</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorcrownmetalliccharmsn</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/f992e7c3c1eaecf14eb8ee197b726d94.png?v=1655902759</image:loc>
      <image:title>Multicolour Crown Designer Metal Charms</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colorevileyemetalliccharmsn</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a8687ccafa16e61596801b1fba191e2f.png?v=1655902857</image:loc>
      <image:title>Dark Blue Evil Eye Designer Metal Charms</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colormultiuncutstonebeadsn</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cc13478061652221135ee08593eb92a6.png?v=1655902893</image:loc>
      <image:title>Multicolour Uncut Stone Beads</image:title>
      <image:caption>colormultiuncutstonebeadsn</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colortransparentsphericalcrystalbeads1n2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/85d0cdd2d4bd8204970718a9c83b3150.png?v=1750929029</image:loc>
      <image:title>Light Pink Transparent Spherical Crystal Beads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colortransparentsphericalcrystalbeads2n2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/d473acf7699255a199e5d6c7ea12e8f5.png?v=1750929028</image:loc>
      <image:title>Mint Green Transparent Spherical Crystal Beads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colortransparentsphericalcrystalbeads3n2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/52fe18034f5fe73cdd5552b64a817baf.png?v=1750929026</image:loc>
      <image:title>Pink Transparent Spherical Crystal Beads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colortransparentsphericalcrystalbeads4n2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c6d9c85c0aef53fd6ff04f699b786e0f.png?v=1750929025</image:loc>
      <image:title>Green Transparent Spherical Crystal Beads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colortransparentsphericalcrystalbeads5n2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a86b33256e90c689da9b38d09293450e.png?v=1750929024</image:loc>
      <image:title>Orange Transparent Spherical Crystal Beads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colortransparentsphericalcrystalbeads6n2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/3930db68c0b9e27ba73457c0a548bd12.png?v=1750929023</image:loc>
      <image:title>Light Purple Transparent Spherical Crystal Beads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colortransparentsphericalcrystalbeads7n2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/59812d7f42d71524c218b6597e32e3b6.png?v=1750929021</image:loc>
      <image:title>Light Blue Transparent Spherical Crystal Beads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colortransparentsphericalcrystalbeads8n2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/b8f48f762af9b5c222763459e0e1bbd5.png?v=1750929020</image:loc>
      <image:title>Lavender Transparent Spherical Crystal Beads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colortransparentsphericalcrystalbeads9n2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/c05c9cfbf0ca94b3023ed99d3f1990fc.png?v=1750929019</image:loc>
      <image:title>Aqua Blue Transparent Spherical Crystal Beads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colortransparentsphericalcrystalbeads10n2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/228a8bf2be87d6390da0e2ddf099fcf8_24b7b2fe-c676-4cc9-8014-2161249709a3.png?v=1750929018</image:loc>
      <image:title>Yellow Transparent Spherical Crystal Beads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/colortransparentsphericalcrystalbeads11n2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/ca1b38c06e53ebb176386b91a39090f9.png?v=1750929016</image:loc>
      <image:title>Purple Transparent Spherical Crystal Beads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/baby-pink-plain-bangalore-raw-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/img_0161_dd10afb9-285f-457a-a31f-724db79154dd.jpg?v=1762838453</image:loc>
      <image:title>Baby Pink Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>baby-pink-plain-bangalore-raw-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-plain-bangalore-raw-silk-fabric-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2eff08a43a30de00b2ae6563d8b91888_60cb4f34-2669-4258-b70c-1ffced03b2fd.jpg?v=1756272915</image:loc>
      <image:title>Silver Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>silverbanglorirawsilkfabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-maroon-plain-bangalore-raw-silk-fabric-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/img_6382.jpg?v=1760156307</image:loc>
      <image:title>Dark Maroon Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>dark-maroon-plain-bangalore-raw-silk-fabric-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pre-cut-golden-orange-plain-bangalore-raw-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/3569b66c5d60e5baa5b78a374d853d87_067479dd-847c-4a4d-8e65-95fa07e911c6.jpg?v=1761545585</image:loc>
      <image:title>Golden Orange Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>goldenorangebanglorirawsilkfabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-plain-bangalore-raw-silk-fabric-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/img_9729.jpg?v=1760156247</image:loc>
      <image:title>Yellow Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>yellow-plain-bangalore-raw-silk-fabric-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/parrot-green-plain-bangalore-raw-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/img_3071.jpg?v=1762838266</image:loc>
      <image:title>Parrot Green Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>parrot-green-plain-bangalore-raw-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/copy-of-deep-purple-plain-bangalore-raw-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/5b26284c-309a-4c00-b140-801c44c3d6dc.jpg?v=1760593777</image:loc>
      <image:title>Deep Purple Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>copy-of-deep-purple-plain-bangalore-raw-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/copy-of-coffee-brown-plain-bangalore-raw-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/89766c8f11011991df6d710a41efe634_4d9cbc9a-cbbf-4b12-abdb-5afe07ebe638.jpg?v=1758516670</image:loc>
      <image:title>Coffee Brown Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>coffeebrownbanglorirawsilkfabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/navy-blue-plain-bangalore-raw-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/7a7ff5872e653e45fd5223b49b4adc20_e4bb0a50-adcd-46bf-9a9e-0b9c436e0238.jpg?v=1763118566</image:loc>
      <image:title>Navy Blue Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>navybanglorirawsilkfabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-plain-bangalore-raw-silk-fabric-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/img_9711.jpg?v=1763117981</image:loc>
      <image:title>Red Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>red-plain-bangalore-raw-silk-fabric-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/copy-of-khaki-brown-plain-bangalore-raw-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/img_9699.jpg?v=1760505316</image:loc>
      <image:title>Khaki Brown Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>copy-of-khaki-brown-plain-bangalore-raw-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/hot-pink-plain-bangalore-raw-silk-fabric-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/img_9712_3833638a-9560-4062-b2f6-1b077135dc75.jpg?v=1763117833</image:loc>
      <image:title>Bright Pink Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>hot-pink-plain-bangalore-raw-silk-fabric-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/copy-of-peacock-blue-plain-bangalore-raw-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/a1ff63e1b9f3b9ce55e996b2c9e03efa_28956fad-f24b-4464-939c-199ac8eb2ad9.jpg?v=1756272900</image:loc>
      <image:title>Peacock Blue Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>peacockbluebanglorirawsilkfabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-blue-circular-designer-embroidered-patch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-1-19-32-25_product_1_1643724145972_aea2c76e-60b1-4fed-bc7d-3325b2e5cf49.jpg?v=1656394864</image:loc>
      <image:title>Red Blue Circular Designer Embroidered Patch</image:title>
      <image:caption>red-blue-embroidered-patch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/ivory-white-fancy-criss-cross-gota-work-embroidered-border</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/43C.png?v=1743576484</image:loc>
      <image:title>Ivory White Fancy Criss Cross Gota Work Embroidered Border</image:title>
      <image:caption>ivory-white-fancy-criss-cross-gota-work-embroidered-border</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-white-golden-zari-chikankari-embroidered-georgette-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220526_165829_compressed.jpg?v=1656947261</image:loc>
      <image:title>Yellow White Golden Zari Chikankari Embroidered Georgette Fabric</image:title>
      <image:caption>yellow-white-golden-zari-chikankari-embroidered-georgette-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/deep-teal-plain-bangalore-raw-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/WhatsAppImage2025-08-22at12.57.45_27165aef.jpg?v=1756302868</image:loc>
      <image:title>Deep Teal Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>deep-teal-plain-bangalore-raw-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/rust-red-golden-floral-motifs-embroidered-taffeta-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220529_155052__01_compressed.jpg?v=1657009457</image:loc>
      <image:title>Rust Red Golden Floral Motifs Embroidered Taffeta Silk Fabric</image:title>
      <image:caption>rust-red-golden-floral-motifs-embroidered-taffeta-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-floral-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220621_123102_compressed.jpg?v=1657011417</image:loc>
      <image:title>Blue Floral Embroidered Chanderi Fabric</image:title>
      <image:caption>blue-floral-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/charcoal-gray-silver-sequins-thread-work-stripes-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220627_181545_compressed.jpg?v=1657011543</image:loc>
      <image:title>Charcoal Gray Silver Sequins &amp; Thread Work Stripes Embroidered Chanderi Fabric</image:title>
      <image:caption>charcoal-gray-silver-sequins-thread-work-stripes-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/mauve-silver-sequins-geometric-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220627_182615__01_compressed.jpg?v=1657011664</image:loc>
      <image:title>Mauve Silver Sequins Geometric Embroidered Chanderi Fabric</image:title>
      <image:caption>mauve-silver-sequins-geometric-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/bottle-green-thread-and-silver-sequins-geometric-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220630_153158__01_compressed.jpg?v=1657011754</image:loc>
      <image:title>Bottle Green Thread and Silver Sequins Geometric Embroidered Chanderi Fabric</image:title>
      <image:caption>bottle-green-thread-and-silver-sequins-geometric-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/off-white-thread-silver-sequins-work-flowers-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220630_153807_compressed.jpg?v=1657011850</image:loc>
      <image:title>Off White Thread &amp; Silver Sequins Work Flowers Embroidered Chanderi Fabric</image:title>
      <image:caption>off-white-thread-silver-sequins-work-flowers-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/navy-blue-white-lakhnawi-floral-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220610_174200_compressed.jpg?v=1657012047</image:loc>
      <image:title>Navy Blue White Lakhnawi Floral Embroidered Chanderi Fabric</image:title>
      <image:caption>navy-blue-white-lakhnawi-floral-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-stripes-machine-embroidered-gota-patti-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220529_162447_compressed.jpg?v=1657012343</image:loc>
      <image:title>White Stripes Machine Embroidered Gota Patti Chanderi Fabric</image:title>
      <image:caption>white-stripes-machine-embroidered-gota-patti-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-multicoloured-thread-silver-zari-embroidered-flowers-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220605_183305_compressed.jpg?v=1657012426</image:loc>
      <image:title>White Multicoloured Thread &amp; Silver Zari Embroidered Flowers Chanderi Fabric</image:title>
      <image:caption>white-multicoloured-thread-silver-zari-embroidered-flowers-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/turquoise-blue-geometric-flowers-embroidered-kantha-work-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220607_174436_compressed.jpg?v=1657012544</image:loc>
      <image:title>Turquoise Blue Geometric Flowers Embroidered Kantha Work Chanderi Fabric</image:title>
      <image:caption>turquoise-blue-geometric-flowers-embroidered-kantha-work-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-geometric-flowers-embroidered-kantha-work-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220607_172820_compressed.jpg?v=1657012658</image:loc>
      <image:title>Blue Geometric Flowers Embroidered Kantha Work Chanderi Fabric</image:title>
      <image:caption>blue-geometric-flowers-embroidered-kantha-work-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/beige-self-embroidered-floral-motifs-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220529_153222_compressed.jpg?v=1657012784</image:loc>
      <image:title>Beige Self Embroidered Floral Motifs Chanderi Fabric</image:title>
      <image:caption>beige-self-embroidered-floral-motifs-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/mint-green-lakhnawi-mirror-work-floral-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220527_172448_compressed.jpg?v=1657012912</image:loc>
      <image:title>Mint Green Lakhnawi &amp; Mirror Work Floral Embroidered Chanderi Fabric</image:title>
      <image:caption>mint-green-lakhnawi-mirror-work-floral-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/mauve-white-chikankari-flowers-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220527_173028_compressed.jpg?v=1657013098</image:loc>
      <image:title>Mauve White Chikankari Flowers Embroidered Chanderi Fabric</image:title>
      <image:caption>mauve-white-chikankari-flowers-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-flowers-thread-embroidered-organza-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220529_141026_compressed.jpg?v=1657013228</image:loc>
      <image:title>Pink Flowers Thread Embroidered Organza Fabric</image:title>
      <image:caption>pink-flowers-thread-embroidered-organza-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/off-white-golden-sequins-geometric-embroidered-tissue-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/precut_golden_tissue_with_all_over_sequins_product_3_1595098843234.jpg?v=1657013575</image:loc>
      <image:title>Off White Golden Sequins Geometric Embroidered Tissue Fabric</image:title>
      <image:caption>off-white-golden-sequins-geometric-embroidered-tissue-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/beige-sequins-and-thread-embroidered-flowers-georgette-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220529_161919_compressed.jpg?v=1657013915</image:loc>
      <image:title>Beige Sequins and Thread Embroidered Flowers Georgette Fabric</image:title>
      <image:caption>beige-sequins-and-thread-embroidered-flowers-georgette-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/bottle-green-plain-crushed-georgette-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220626_162108__01_compressed.jpg?v=1755799392</image:loc>
      <image:title>Bottle Green Plain Crushed Georgette Fabric</image:title>
      <image:caption>bottle-green-plain-crushed-georgette-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/off-white-sustainable-linen-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220630_135654_compressed.jpg?v=1762711158</image:loc>
      <image:title>Off White Linen Fabric</image:title>
      <image:caption>off-white-sustainable-linen-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/rust-red-golden-sequins-rose-motifs-embroidered-taffeta-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220529_161349_compressed.jpg?v=1657015072</image:loc>
      <image:title>Rust Red Golden Sequins Rose Motifs Embroidered Taffeta Silk Fabric</image:title>
      <image:caption>rust-red-golden-sequins-rose-motifs-embroidered-taffeta-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-assorted-resin-bezel-connectors</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/resin-bezel-connectors-_2813_29.jpg?v=1743226579</image:loc>
      <image:title>Silver Assorted Resin Bezel Rakhi Connectors</image:title>
      <image:caption>silver-assorted-resin-bezel-connectors</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-chanderi-golden-dori-thread-embroidered-patch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220630_164731_compressed.jpg?v=1657097063</image:loc>
      <image:title>Pink Chanderi Golden Dori &amp; Thread Embroidered Patch</image:title>
      <image:caption>pink-chanderi-golden-dori-thread-embroidered-patch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-chanderi-golden-dori-embroidered-patch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220630_164420_compressed.jpg?v=1657097162</image:loc>
      <image:title>Yellow Chanderi Golden Dori Embroidered Patch</image:title>
      <image:caption>yellow-chanderi-golden-dori-embroidered-patch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-crepe-golden-dori-thread-embroidered-patch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220630_155258_compressed.jpg?v=1657097219</image:loc>
      <image:title>White Crepe Golden Dori &amp; Thread Embroidered Patch</image:title>
      <image:caption>white-crepe-golden-dori-thread-embroidered-patch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-golden-zari-and-sequins-work-embroidered-border</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220626_150038_compressed.jpg?v=1657097357</image:loc>
      <image:title>Black Golden Zari and Sequins Work Embroidered Border</image:title>
      <image:caption>black-golden-zari-and-sequins-work-embroidered-border</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/beige-thread-work-embroidered-chanderi-border</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220610_180646_compressed.jpg?v=1657097719</image:loc>
      <image:title>Beige Thread Work Embroidered Chanderi Border</image:title>
      <image:caption>beige-thread-work-embroidered-chanderi-border</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-sequins-and-zari-work-matt-embroidered-border</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220529_170215_compressed.jpg?v=1754283975</image:loc>
      <image:title>Golden Sequins and Zari Work Matt Embroidered Border</image:title>
      <image:caption>golden-sequins-and-zari-work-matt-embroidered-border</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/precut-2-35-metre-white-golden-dori-thread-embroidered-mono-net-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220526_171855_compressed.jpg?v=1657108959</image:loc>
      <image:title>Precut 2.35 Metre White Golden Dori &amp; Thread Embroidered Mono Net Fabric</image:title>
      <image:caption>precut-2-35-metre-white-golden-dori-thread-embroidered-mono-net-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/brick-red-brown-white-stripes-viscose-muslin-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/brick_brown_white_viscose_muslin_fabric_3.jpg?v=1657111082</image:loc>
      <image:title>Brick Red Brown White Stripes Viscose Muslin Silk Fabric</image:title>
      <image:caption>brick-red-brown-white-stripes-viscose-muslin-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/violet-white-geometric-viscose-muslin-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/violet_white_circles_viscose_muslin_fabric_1.jpg?v=1657175776</image:loc>
      <image:title>Violet White Geometric Viscose Muslin Silk Fabric</image:title>
      <image:caption>violet-white-geometric-viscose-muslin-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-white-geometric-viscose-muslin-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/dark_pink_white_circles_viscose_muslin_fabric_1.jpg?v=1657177593</image:loc>
      <image:title>Pink &amp; White Geometric Viscose Muslin Silk Fabric</image:title>
      <image:caption>pink-white-geometric-viscose-muslin-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pastel-green-white-stripes-viscose-muslin-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/white_lines_suttle_green_viscose_muslin_fabric_3.jpg?v=1657178013</image:loc>
      <image:title>Pastel Green White Stripes Viscose Muslin Fabric</image:title>
      <image:caption>pastel-green-white-stripes-viscose-muslin-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pastel-blue-white-stripes-viscose-muslin-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/white_lines_suttle_blue_viscose_muslin_fabric_3.jpg?v=1657178095</image:loc>
      <image:title>Pastel Blue White Stripes Viscose Muslin Fabric</image:title>
      <image:caption>pastel-blue-white-stripes-viscose-muslin-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-gray-mughal-flowers-viscose-muslin-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/white_florals_blue_grey_viscose_muslin_fabric_3.jpg?v=1657178165</image:loc>
      <image:title>Dark Gray Mughal Flowers Viscose Muslin Fabric</image:title>
      <image:caption>dark-gray-mughal-flowers-viscose-muslin-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/sea-blue-multicolour-flowers-viscose-muslin-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/sea_blue_multi_floral_viscose_muslin_fabric_3.jpg?v=1657178546</image:loc>
      <image:title>Sea Blue Multicolour Flowers Viscose Muslin Fabric</image:title>
      <image:caption>sea-blue-multicolour-flowers-viscose-muslin-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/purple-violet-chevron-dots-viscose-muslin-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/violet_bandhej_chevron_viscose_muslin_fabric_2.jpg?v=1657178792</image:loc>
      <image:title>Purple Violet Chevron Dots Viscose Muslin Fabric</image:title>
      <image:caption>purple-violet-chevron-dots-viscose-muslin-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-multicolour-flowers-viscose-muslin-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/blue_flowers_peach_viscose_muslin_fabric_2.jpg?v=1657179000</image:loc>
      <image:title>Peach Multicolour Flowers Viscose Muslin Fabric</image:title>
      <image:caption>peach-multicolour-flowers-viscose-muslin-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-golden-geometric-golden-embellished-dots-dyeable-muslin-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220607_171049_compressed.jpg?v=1671431224</image:loc>
      <image:title>White Golden Geometric Golden Embellished Dots Dyeable Muslin Cotton Fabric</image:title>
      <image:caption>white-golden-geometric-golden-embellished-dots-dyeable-muslin-cotton-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/discounted-colourful-thread-cutters</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/STSC000051_d95a8565-0d53-4548-98a6-29a533ce66ba.jpg?v=1657524992</image:loc>
      <image:title>Discounted Colourful Thread Cutters</image:title>
      <image:caption>colourful-thread-cutters</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/copy-of-off-white-plain-bangalore-raw-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/img_8104.jpg?v=1762146441</image:loc>
      <image:title>Off White Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>copy-of-off-white-plain-bangalore-raw-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-fabric-flower-lapel-pin</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1_b0d1e6be-712a-4522-ad20-6187dfc34f89.png?v=1658392121</image:loc>
      <image:title>Black Fabric Flower Lapel Pin</image:title>
      <image:caption>black-fabric-flower-lapel-pin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-fabric-flower-lapel-pin</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/untitled-design-_2821_29.png?v=1657965597</image:loc>
      <image:title>White Fabric Flower Lapel Pin</image:title>
      <image:caption>white-fabric-flower-lapel-pin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/baby-pink-golden-foil-flowers-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220703_170940_compressed.jpg?v=1657893323</image:loc>
      <image:title>Baby Pink Golden Foil Flowers Embroidered Chanderi Fabric</image:title>
      <image:caption>baby-pink-golden-foil-flowers-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/mauve-purple-floral-thread-and-sequins-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220703_165819__01_compressed.jpg?v=1657893436</image:loc>
      <image:title>Mauve Purple Floral Thread and Sequins Embroidered Chanderi Fabric</image:title>
      <image:caption>mauve-purple-floral-thread-and-sequins-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-blue-floral-chikankari-and-zari-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220703_145341_compressed.jpg?v=1657893546</image:loc>
      <image:title>Dark Blue Floral Chikankari and Zari Embroidered Chanderi Fabric</image:title>
      <image:caption>dark-blue-floral-chikankari-and-zari-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/rose-pink-floral-thread-and-sequins-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220703_151725_compressed.jpg?v=1657893645</image:loc>
      <image:title>Rose Pink Floral Thread and Sequins Embroidered Chanderi Fabric</image:title>
      <image:caption>rose-pink-floral-thread-and-sequins-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-silver-sequins-flowers-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220703_152746_compressed.jpg?v=1657893746</image:loc>
      <image:title>Pink Silver Sequins Flowers Embroidered Chanderi Fabric</image:title>
      <image:caption>pink-silver-sequins-flowers-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cobalt-blue-silver-sequins-flowers-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220703_154521_compressed.jpg?v=1657893836</image:loc>
      <image:title>Cobalt Blue Silver Sequins Flowers Embroidered Chanderi Fabric</image:title>
      <image:caption>cobalt-blue-silver-sequins-flowers-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-green-pink-thread-and-sequins-flowers-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220703_160003_compressed.jpg?v=1657893941</image:loc>
      <image:title>Light Green Pink Thread and Sequins Flowers Embroidered Chanderi Fabric</image:title>
      <image:caption>light-green-pink-thread-and-sequins-flowers-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-blue-thread-and-sequins-flowers-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220703_162233_compressed.jpg?v=1657894029</image:loc>
      <image:title>Dark Blue Thread and Sequins Flowers Embroidered Chanderi Fabric</image:title>
      <image:caption>dark-blue-thread-and-sequins-flowers-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-silver-sequins-flowers-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220703_163003_compressed.jpg?v=1657894126</image:loc>
      <image:title>Peach Silver Sequins Flowers Embroidered Chanderi Fabric</image:title>
      <image:caption>peach-silver-sequins-flowers-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/maroon-golden-flowers-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220525_163053__01_compressed.jpg?v=1657894280</image:loc>
      <image:title>Maroon Golden Flowers Embroidered Chanderi Fabric</image:title>
      <image:caption>maroon-golden-flowers-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/gray-white-paisleys-lakhnawi-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2021-11-10-20-45-58_product_2_1636557358470_8d89517a-13b5-4954-8049-a43117392209.jpg?v=1657894707</image:loc>
      <image:title>Gray White Paisleys Lakhnawi Embroidered Chanderi Fabric</image:title>
      <image:caption>gray-white-paisleys-lakhnawi-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-golden-abstract-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20211120_162744_compressed.jpg?v=1657894816</image:loc>
      <image:title>Green Golden Abstract Embroidered Chanderi Fabric</image:title>
      <image:caption>green-golden-abstract-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-white-flowers-rose-gold-sequins-work-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220419_174559_compressed.jpg?v=1657894981</image:loc>
      <image:title>Peach White Flowers Rose Gold Sequins Work Embroidered Chanderi Fabric</image:title>
      <image:caption>peach-white-flowers-rose-gold-sequins-work-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/sea-blue-lakhnawi-flowers-embroidered-chanderi-fabric-with-mirror-work</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220419_171043_compressed.jpg?v=1657895077</image:loc>
      <image:title>Sea Blue Lakhnawi Flowers Embroidered Chanderi Fabric with Mirror Work</image:title>
      <image:caption>sea-blue-lakhnawi-flowers-embroidered-chanderi-fabric-with-mirror-work</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/mauve-gold-dual-shade-plain-organza-tissue-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220526_164617_compressed.jpg?v=1657895388</image:loc>
      <image:title>Mauve Gold Dual Shade Plain Organza Tissue Fabric</image:title>
      <image:caption>mauve-gold-dual-shade-plain-organza-tissue-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/bright-pink-golden-dori-and-sequins-flowers-embroidered-taffeta-silk-fabric-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220419_175438_compressed_927c1d94-bc2c-46d0-a376-654b779a9845.jpg?v=1657896033</image:loc>
      <image:title>Bright Pink Golden Dori and Sequins Flowers Embroidered Taffeta Silk Fabric</image:title>
      <image:caption>bright-pink-golden-dori-and-sequins-flowers-embroidered-taffeta-silk-fabric-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pre-cut-1-meter-white-plain-self-stripes-dyeable-cotton-rayon-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2022-2-16-12-12-50_product_1_1645042370463_a41feb7c-0cf3-4979-b72b-b3256256e8a5.jpg?v=1658149461</image:loc>
      <image:title>Precut 1 Meter White Plain Self Stripes Dyeable Cotton Rayon Fabric</image:title>
      <image:caption>white-dyeable-self-lining-cotton-rayon-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-paisley-chikankari-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220711_141850_compressed.jpg?v=1658218780</image:loc>
      <image:title>Peach Paisley Chikankari Embroidered Chanderi Fabric</image:title>
      <image:caption>peach-paisley-chikankari-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-transparent-can-can-lace</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220526_173032_compressed.jpg?v=1658226465</image:loc>
      <image:title>White Transparent Can Can Lace</image:title>
      <image:caption>white-transparent-can-can-lace</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/grey-multicolor-silver-sequins-and-thread-embroidered-taffeta-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220426_173450_compressed.jpg?v=1658227636</image:loc>
      <image:title>Grey Multicolor Silver Sequins and Thread Embroidered Taffeta Silk Fabric</image:title>
      <image:caption>grey-multicolor-silver-sequins-and-thread-embroidered-taffeta-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-flower-white-crystal-stone-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1-0main.jpg?v=1658313616</image:loc>
      <image:title>Golden Flower White Crystal Stone Brooch</image:title>
      <image:caption>golden-flower-white-crystal-stone-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/rose-gold-white-crystal-eye-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/5-0main.jpg?v=1658313940</image:loc>
      <image:title>Rose Gold White Crystal Eye Brooch</image:title>
      <image:caption>rose-gold-white-crystal-eye-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/generic-silk-thread-combo-pack-of-10-colors</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/13_206d2012-de06-41c7-b240-1899afba978c.png?v=1658316117</image:loc>
      <image:title>Generic Silk Thread Combo Pack of 10 Colors</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/generic-silk-thread-combo-pack-of-10-colors-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/14_1887b8f4-b333-47a4-9b40-860a8059872e.png?v=1658316170</image:loc>
      <image:title>Generic Silk Thread Combo Pack of 10 Colors</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-and-black-stone-work-fancy-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2-0main.jpg?v=1658316831</image:loc>
      <image:title>Silver And Black Stone Work Fancy Brooch</image:title>
      <image:caption>silver-and-black-stone-work-fancy-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-and-golden-stone-work-designer-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/3-0main.jpg?v=1658316979</image:loc>
      <image:title>Silver And Golden Stone Work  Designer Brooch</image:title>
      <image:caption>silver-and-golden-stone-work-designer-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-stone-leaf-design-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/4-0main.jpg?v=1658317193</image:loc>
      <image:title>Silver Stone leaf Design Brooch</image:title>
      <image:caption>silver-stone-leaf-design-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-stone-work-golden-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6-0main.jpg?v=1658320203</image:loc>
      <image:title>White Stone Work Golden Brooch</image:title>
      <image:caption>white-stone-work-golden-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-white-stone-work-leaf-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/22-0.jpg?v=1658320548</image:loc>
      <image:title>Silver White Stone Work Leaf Brooch</image:title>
      <image:caption>silver-white-stone-work-leaf-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-pearl-silver-flower-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/18-0.jpg?v=1658320759</image:loc>
      <image:title>White Pearl Silver Flower Brooch</image:title>
      <image:caption>white-pearl-silver-flower-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-rusted-flower-design-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/16-0.jpg?v=1658321100</image:loc>
      <image:title>Silver Rusted Flower Design Brooch</image:title>
      <image:caption>silver-rusted-flower-design-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-rusted-leaf-design-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/12-0.jpg?v=1658321199</image:loc>
      <image:title>Silver Rusted Leaf Design Brooch</image:title>
      <image:caption>silver-rusted-leaf-design-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-white-stone-leaf-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/11-0.jpg?v=1658321337</image:loc>
      <image:title>Silver White Stone Leaf Brooch</image:title>
      <image:caption>silver-white-stone-leaf-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-rusted-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9-0main.jpg?v=1658321460</image:loc>
      <image:title>Silver Rusted Brooch</image:title>
      <image:caption>silver-rusted-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-stone-work-rose-gold-brooch-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/8-0main.jpg?v=1658321569</image:loc>
      <image:title>White Stone Work Rose Gold Brooch</image:title>
      <image:caption>white-stone-work-rose-gold-brooch-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/maroon-chanderi-with-white-embroidered-lakhnawi-motifs</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220711_171240_compressed.jpg?v=1658736593</image:loc>
      <image:title>Maroon White Paisleys Lakhnawi Embroidered Chanderi Fabric</image:title>
      <image:caption>maroon-chanderi-with-white-embroidered-lakhnawi-motifs</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-white-sequins-flowers-chikankari-embroidered-georgette-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220711_163429_compressed.jpg?v=1658736898</image:loc>
      <image:title>Peach White Sequins Flowers Chikankari Embroidered Georgette Fabric</image:title>
      <image:caption>peach-white-sequins-flowers-chikankari-embroidered-georgette-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/gray-foil-gota-flowers-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220711_162040_compressed.jpg?v=1658737022</image:loc>
      <image:title>Gray Foil Gota Flowers Embroidered Chanderi Fabric</image:title>
      <image:caption>gray-foil-gota-flowers-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/rose-pink-chikankari-flowers-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220711_143058_compressed.jpg?v=1658737383</image:loc>
      <image:title>Rose Pink Chikankari Flowers Embroidered Chanderi Fabric</image:title>
      <image:caption>rose-pink-chikankari-flowers-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/beige-rose-gold-thread-and-sequins-flowers-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220719_144102_compressed.jpg?v=1658737760</image:loc>
      <image:title>Beige Rose Gold Thread and Sequins Flowers Embroidered Chanderi Fabric</image:title>
      <image:caption>beige-rose-gold-thread-and-sequins-flowers-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/hot-pink-golden-sequins-flowers-embroidered-taffeta-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220719_143538_compressed.jpg?v=1756638764</image:loc>
      <image:title>Hot Pink Golden Sequins Flowers Embroidered Taffeta Silk Fabric</image:title>
      <image:caption>hot-pink-golden-sequins-flowers-embroidered-taffeta-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-green-thread-flowers-embroidered-mono-net-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220719_142741_compressed.jpg?v=1658738086</image:loc>
      <image:title>White Green Thread Flowers Embroidered Mono Net Fabric</image:title>
      <image:caption>white-green-thread-flowers-embroidered-mono-net-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-plain-metallic-brocade-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220719_142050_compressed.jpg?v=1658741183</image:loc>
      <image:title>Golden Plain Metallic Brocade Fabric</image:title>
      <image:caption>golden-plain-metallic-brocade-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/maroon-golden-sequins-stripes-embroidered-net-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220718_174437_compressed.jpg?v=1658741546</image:loc>
      <image:title>Maroon Golden Sequins Stripes Embroidered Net Fabric</image:title>
      <image:caption>maroon-golden-sequins-stripes-embroidered-net-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-pink-glass-pearls-6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_9900.jpg?v=1658747039</image:loc>
      <image:title>Light Pink Czech Glass Pearls- 6 mm</image:title>
      <image:caption>light-pink-glass-pearls-6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-glass-pearls-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_0027_a3600dc1-6610-44c3-b206-1a2c1da88eff.jpg?v=1658747375</image:loc>
      <image:title>White Czech Glass Pearls- 10 mm</image:title>
      <image:caption>white-glass-pearls-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dull-white-glass-pearls-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_0011.jpg?v=1658747650</image:loc>
      <image:title>Dull White Czech Glass Pearls- 10 mm</image:title>
      <image:caption>dull-white-glass-pearls-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/bright-white-glass-pearls-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_9997.jpg?v=1658747724</image:loc>
      <image:title>Bright White Czech Glass Pearls - 10 mm</image:title>
      <image:caption>bright-white-glass-pearls-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-glass-pearls-6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_9903.jpg?v=1658747787</image:loc>
      <image:title>White Czech Glass Pearls - 6 mm</image:title>
      <image:caption>white-glass-pearls-6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/bright-white-glass-pearls-6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_9892.jpg?v=1658748005</image:loc>
      <image:title>Bright White Czech Glass Pearls - 6 mm</image:title>
      <image:caption>bright-white-glass-pearls-6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/milky-white-glass-pearls-6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_9887.jpg?v=1658748076</image:loc>
      <image:title>Milky White Czech Glass Pearls - 6 mm</image:title>
      <image:caption>milky-white-glass-pearls-6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/off-white-glass-pearls-6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_9880.jpg?v=1658748145</image:loc>
      <image:title>Off White Czech Glass Pearls - 6 mm</image:title>
      <image:caption>off-white-glass-pearls-6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/baby-pink-glass-pearls-6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_9876.jpg?v=1658748215</image:loc>
      <image:title>Baby Pink Czech Glass Pearls - 6 mm</image:title>
      <image:caption>baby-pink-glass-pearls-6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-glass-pearls-6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_9868.jpg?v=1658748520</image:loc>
      <image:title>Pink Czech Glass Pearls - 6 mm</image:title>
      <image:caption>pink-glass-pearls-6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/shiny-white-glass-pearls-6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_9863.jpg?v=1658748563</image:loc>
      <image:title>Shiny White Czech Glass Pearls - 6 mm</image:title>
      <image:caption>shiny-white-glass-pearls-6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/matte-white-glass-pearls-6-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_9859.jpg?v=1658748665</image:loc>
      <image:title>Matte White Czech Glass Pearls - 6 mm</image:title>
      <image:caption>matte-white-glass-pearls-6-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/shiny-white-glass-pearls-10-mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_0014_0fabb111-38e4-4b37-9bfe-5baf8bd18c54.jpg?v=1658748957</image:loc>
      <image:title>Shiny White Czech Glass Pearls - 10 mm</image:title>
      <image:caption>shiny-white-glass-pearls-10-mm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-glass-pearls-10-mm-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_0006_f6ce6fa1-c822-4c2b-bbe9-1e12520577cf.jpg?v=1658749052</image:loc>
      <image:title>White Czech Glass Pearls  - 10 mm</image:title>
      <image:caption>white-glass-pearls-10-mm-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cream-spherical-ceramic-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1a_d17a902a-4573-4033-84ad-f3771809758c.png?v=1658822725</image:loc>
      <image:title>Cream Spherical Glass Beads</image:title>
      <image:caption>cream-spherical-ceramic-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fern-green-spherical-ceramic-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2a_268748d2-ba78-4f79-b490-97d58cc36852.png?v=1658822852</image:loc>
      <image:title>Fern Green Spherical Ceramic Beads</image:title>
      <image:caption>fern-green-spherical-ceramic-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-spherical-ceramic-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/3a_bdbb902e-1fa3-41ec-a6fc-bb919e6bdec4.png?v=1658822938</image:loc>
      <image:title>Yellow Spherical Ceramic Beads</image:title>
      <image:caption>yellow-spherical-ceramic-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-green-spherical-ceramic-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/5a.png?v=1658823883</image:loc>
      <image:title>Light Green Spherical Ceramic Beads</image:title>
      <image:caption>light-green-spherical-ceramic-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peachy-red-spherical-ceramic-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6a_16f0cbb0-b3f9-48e2-adb8-a34e4f44ad85.png?v=1658823944</image:loc>
      <image:title>Peachy Red Spherical Ceramic Beads</image:title>
      <image:caption>peachy-red-spherical-ceramic-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-spherical-ceramic-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/10a_f9768a27-e61a-4ccd-8665-f1f879c781aa.png?v=1658824254</image:loc>
      <image:title>White Spherical Glass Beads</image:title>
      <image:caption>white-spherical-ceramic-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-tube-ceramic-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/11a_a7e9fd5e-7ad2-42ac-85ab-3b91bcbf835f.png?v=1658824408</image:loc>
      <image:title>Green Tube Glass Beads</image:title>
      <image:caption>green-tube-ceramic-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-tube-ceramic-beads-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/16a_fcee8a02-1e3d-47b0-aa4f-16f8a67f55e4.png?v=1658824712</image:loc>
      <image:title>Green Tube Ceramic Beads</image:title>
      <image:caption>green-tube-ceramic-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-kundan-work-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/24a.png?v=1658825578</image:loc>
      <image:title>Yellow Kundan Work Beads</image:title>
      <image:caption>yellow-kundan-work-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-sky-blue-kundan-work-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/25a.png?v=1658825669</image:loc>
      <image:title>Dark Sky Blue Kundan Work Beads</image:title>
      <image:caption>dark-sky-blue-kundan-work-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-sapphire-blue-kundan-work-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/26a.png?v=1658825730</image:loc>
      <image:title>Light Sapphire Blue Kundan Work Beads</image:title>
      <image:caption>light-sapphire-blue-kundan-work-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cream-kundan-work-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/29a.png?v=1658825872</image:loc>
      <image:title>Cream Kundan Work Beads</image:title>
      <image:caption>cream-kundan-work-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-orange-kundan-work-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/35a.png?v=1658825916</image:loc>
      <image:title>Dark Orange Kundan Work Beads</image:title>
      <image:caption>dark-orange-kundan-work-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/magenta-kundan-work-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/34a.png?v=1658825962</image:loc>
      <image:title>Magenta Kundan Work Beads</image:title>
      <image:caption>magenta-kundan-work-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/maroon-kundan-work-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/32a.png?v=1658826119</image:loc>
      <image:title>Maroon Kundan Work Beads</image:title>
      <image:caption>maroon-kundan-work-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/royal-blue-kundan-work-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/30a.png?v=1658826234</image:loc>
      <image:title>Royal Blue Kundan Work Beads</image:title>
      <image:caption>royal-blue-kundan-work-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-kundan-work-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/41a.png?v=1658826628</image:loc>
      <image:title>White Kundan Work Beads</image:title>
      <image:caption>white-kundan-work-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolour-czech-crystal-clay-spherical-shamballa-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/27_3ca3b93d-67f7-441d-8b43-51b347c29815.png?v=1658827430</image:loc>
      <image:title>Multicolour Czech Crystal Clay Spherical Shamballa Beads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/antique-gold-king-crown-diamond-stud-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1_1485cde2-3280-45ec-824e-8b903dea9c82.png?v=1658834039</image:loc>
      <image:title>Antique Gold King Crown Diamond Stud Brooch</image:title>
      <image:caption>antique-gold-king-crown-diamond-stud-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-lion-face-brooch-with-silver-chain</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/untitled-design-_2820_29.png?v=1658835056</image:loc>
      <image:title>Golden Lion Face Brooch with Silver Chain</image:title>
      <image:caption>golden-lion-face-brooch-with-silver-chain</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolour-2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-23-_281_29.jpg?v=1658836509</image:loc>
      <image:title>Multicolour 2-Hole Circular Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-circular-plastic-shirt-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cl-18.jpg?v=1658837307</image:loc>
      <image:title>Black Circular Plastic Shirt Buttons</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-circular-plastic-shirt-buttons-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cl-8.jpg?v=1658837758</image:loc>
      <image:title>Black Circular Plastic Shirt Buttons with Blue and White Stripes</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-circular-plastic-shirt-buttons-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cl-17.jpg?v=1658838253</image:loc>
      <image:title>Black Circular Plastic Shirt Buttons with Yellow Design</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-circular-plastic-shirt-buttons-3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cl-14.jpg?v=1658838426</image:loc>
      <image:title>Black Circular Plastic Shirt Buttons with Red and Blue Design</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-circular-plastic-shirt-buttons-4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cl-12.jpg?v=1658838661</image:loc>
      <image:title>Black Circular Plastic Shirt Buttons with Red Design</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-circular-plastic-shirt-buttons-with-yellow-stripes</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cl-4.jpg?v=1658839567</image:loc>
      <image:title>Black Circular Plastic Shirt Buttons with Yellow Stripes</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-circular-plastic-buttons-with-blue-and-pink-design</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cl-3.jpg?v=1658840248</image:loc>
      <image:title>Black Circular Plastic Shirt Buttons with Blue and Pink Design</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-circular-plastic-shirt-buttons-with-red-design</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cl-19.jpg?v=1658899275</image:loc>
      <image:title>Black Circular Plastic Shirt Buttons with Red Design</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-fancy-2-hole-wooden-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-9-_281_29.jpg?v=1658899481</image:loc>
      <image:title>Pink Fancy 2-Hole Circular Wooden Buttons</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/brown-2-hole-flower-printed-circular-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-20-_282_29.jpg?v=1658900107</image:loc>
      <image:title>Brown 2-Hole Flower Printed Circular Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-circular-plastic-shirt-buttons-with-red-and-white-lines</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cl-22.jpg?v=1658900762</image:loc>
      <image:title>Black Circular Plastic Shirt Buttons with Red and White Lines</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-circular-plastic-shirt-buttons-with-white-stripe</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cl-20.jpg?v=1658900988</image:loc>
      <image:title>Black Circular Plastic Shirt Buttons with White Stripe</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-circular-plastic-shirt-buttons-with-red-blue-and-white-stripes</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cl-21.jpg?v=1658904183</image:loc>
      <image:title>Black Circular Plastic Shirt Buttons with Red, Blue and White Stripes</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/navy-blue-with-foil-gota-patti-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/navy-blue1.jpg?v=1658905378</image:loc>
      <image:title>Navy Blue with Foil Gota Patti Embroidered Chanderi Fabric</image:title>
      <image:caption>navy-blue-with-foil-gota-patti-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/purple-plain-crepe-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220713_181615__01_compressed.jpg?v=1658905771</image:loc>
      <image:title>Purple Plain Crepe Fabric</image:title>
      <image:caption>purple-plain-crepe-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolour-2-hole-circular-wooden-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-2-_281_29.jpg?v=1658905883</image:loc>
      <image:title>Multicolour 2-Hole Circular Wooden Buttons</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/brown-leaf-design-2-hole-circular-wooden-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-_283_29.jpg?v=1658906100</image:loc>
      <image:title>Brown Leaf Design 2-Hole Circular Wooden Buttons</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/brown-multicolour-design-2-hole-circular-wooden-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-8-_282_29.jpg?v=1658906375</image:loc>
      <image:title>Brown Multicolour Design 2-Hole Circular Wooden Buttons</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/magenta-pink-chikankari-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/sa-s1697.jpg?v=1658906565</image:loc>
      <image:title>Magenta Pink Chikankari Embroidered Chanderi Fabric</image:title>
      <image:caption>magenta-pink-chikankari-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/brown-flower-design-2-hole-wooden-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-496-_281_29.jpg?v=1658907042</image:loc>
      <image:title>Brown Flower Design 2-Hole Circular Wooden Buttons</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/brown-multicolour-floral-design-2-hole-circular-wooden-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-26-_281_29.jpg?v=1658907312</image:loc>
      <image:title>Brown Multicolour Floral Design 2-Hole Circular Wooden Buttons</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-491-_281_29.jpg?v=1658907673</image:loc>
      <image:title>Multicolour Floral Design 2-Hole Circular Wooden Buttons</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolour-design-2-hole-circular-wooden-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-500-_283_29.jpg?v=1658907984</image:loc>
      <image:title>Multicolour Design 2-Hole Circular Wooden Buttons</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-brown-2-hole-wooden-buttons-with-orange-design</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-12-_281_29.jpg?v=1658908475</image:loc>
      <image:title>Dark Brown 2-Hole Circular Wooden Buttons with Orange Design</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-plain-crepe-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/30a_ddad3405-3baf-465c-8977-01bc91ac0e41.png?v=1737962082</image:loc>
      <image:title>Black Plain Crepe Fabric</image:title>
      <image:caption>black-plain-crepe-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-golden-black-nylon-net-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/21b_d88c3fc6-09aa-4a36-a07c-2ab73b3df7bd.png?v=1753087872</image:loc>
      <image:title>Light Golden Black Nylon Net Fabric</image:title>
      <image:caption>light-golden-black-nylon-net-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/chocolate-brown-geometric-woven-cotton-crochet-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/27b_56edc337-f995-4e29-a986-5d60de5c8d6b.png?v=1753087871</image:loc>
      <image:title>Chocolate Brown Geometric Woven Cotton Crochet Fabric</image:title>
      <image:caption>chocolate-brown-geometric-woven-cotton-crochet-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/off-white-2-hole-circular-wooden-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-815-_283_29.jpg?v=1659007977</image:loc>
      <image:title>Off White 2-Hole Circular Wooden Buttons with Brown Design</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/off-white-2-hole-wooden-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-824-_281_29.jpg?v=1659008298</image:loc>
      <image:title>Off White 2-Hole Circular Wooden Buttons</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/off-white-2-hole-circular-wooden-buttons-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-817-_282_29.jpg?v=1659008727</image:loc>
      <image:title>Off-White 2-Hole Circular Wooden Buttons</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolour-checks-yarn-dyed-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/img_20250219_133403.jpg?v=1769409145</image:loc>
      <image:title>Multicolour Checks Yarn Dyed Cotton Fabric</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/orange-plaid-checks-yarn-dyed-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/img-20220728-wa0111.jpg?v=1747549681</image:loc>
      <image:title>Maroon Plaid Checks Yarn Dyed Cotton Fabric</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-blue-checks-yarn-dyed-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/img_20241202_175217.jpg?v=1747549658</image:loc>
      <image:title>Light Blue Checks Yarn Dyed Cotton Fabric</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-violet-checks-yarn-dyed-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img-20220728-wa0011_result.jpg?v=1770095763</image:loc>
      <image:title>Light Violet Checks Yarn Dyed Cotton Fabric</image:title>
      <image:caption>light-violet-checks-yarn-dyed-cotton-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/purple-pink-lurex-checks-yarn-dyed-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img-20220728-wa0073_result.jpg?v=1760448230</image:loc>
      <image:title>Purple Pink Lurex Checks Yarn Dyed Cotton Fabric</image:title>
      <image:caption>purple-pink-lurex-checks-yarn-dyed-cotton-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolour-pink-yarn-dyed-checks-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/1775032929413.jpg?v=1775472188</image:loc>
      <image:title>Multicolour Pink Checks Yarn Dyed Cotton Fabric</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pastel-multicolour-yarn-dyed-checks-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img-20220728-wa0037_result.jpg?v=1749101350</image:loc>
      <image:title>Pastel Multicolour Yarn Dyed Checks Cotton Fabric</image:title>
      <image:caption>pastel-multicolour-yarn-dyed-checks-cotton-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-blue-gingham-check-yarn-dyed-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/img_20241224_134457.jpg?v=1772281295</image:loc>
      <image:title>Dark Blue Gingham Check Yarn Dyed Cotton Fabric</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/beige-2-hole-circular-wooden-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-822-_282_29.jpg?v=1659184575</image:loc>
      <image:title>Beige 2-Hole Circular Wooden Buttons</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/beige-2-hole-circular-wooden-buttons-with-teddy-design</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-783-_282_29.jpg?v=1659184759</image:loc>
      <image:title>Beige 2-Hole Circular Wooden Buttons with Teddy Design</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/off-white-2-hole-circular-wooden-buttons-with-floral-design</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-788-_282_29.jpg?v=1659184946</image:loc>
      <image:title>Off-White 2-Hole Circular Wooden Buttons with Floral Design</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/beige-2-hole-circular-wooden-buttons-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-828-_281_29.jpg?v=1659185136</image:loc>
      <image:title>Beige 2-Hole Circular Wooden Buttons</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/american-diamond-stone-leaf-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/17.0.jpg?v=1659185456</image:loc>
      <image:title>Golden American Diamond Stone Leaf Brooch</image:title>
      <image:caption>american-diamond-stone-leaf-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-bouquet-design-with-pearl-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/13.0.jpg?v=1659185553</image:loc>
      <image:title>Golden Bouquet Design With Pearl Brooch</image:title>
      <image:caption>golden-bouquet-design-with-pearl-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-curve-design-with-centre-stone-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/15.0.jpg?v=1659185590</image:loc>
      <image:title>Golden Curve Design With Centre Stone Brooch</image:title>
      <image:caption>golden-curve-design-with-centre-stone-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-fan-design-with-pearl-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/14.0.jpg?v=1659185635</image:loc>
      <image:title>Golden Fan Design With Pearl Brooch</image:title>
      <image:caption>golden-fan-design-with-pearl-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-flower-with-leaf-stone-studded-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/24.0.jpg?v=1659185661</image:loc>
      <image:title>Golden Flower With Leaf Stone Studded Brooch</image:title>
      <image:caption>golden-flower-with-leaf-stone-studded-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-flower-with-pearl-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/19.0.jpg?v=1659185710</image:loc>
      <image:title>Golden Flower With Pearl Brooch</image:title>
      <image:caption>golden-flower-with-pearl-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-stone-studded-butterfly-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/21.0.jpg?v=1659185738</image:loc>
      <image:title>Golden Stone Studded Butterfly Brooch</image:title>
      <image:caption>golden-stone-studded-butterfly-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-stone-studded-diamond-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/20.0_fc6985f7-c337-4430-8c38-92453a508828.jpg?v=1659185784</image:loc>
      <image:title>Golden Stone Studded Diamond Brooch</image:title>
      <image:caption>golden-stone-studded-diamond-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-and-white-checks-plaid-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/img_20241203_130808.jpg?v=1747803982</image:loc>
      <image:title>Corn Blue Checks Plaid Cotton Fabric</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dyeable-peacock-motifs-lakhnavi-embroidered-organza-border</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220419_162109__01_compressed.jpg?v=1659353456</image:loc>
      <image:title>White Dyeable Peacock Motifs Lakhnavi Embroidered Organza Border</image:title>
      <image:caption>dyeable-peacock-motifs-lakhnavi-embroidered-organza-border</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-golden-dyeable-designer-organza-border</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220417_165421_compressed.jpg?v=1659353822</image:loc>
      <image:title>White Golden Dyeable Designer Organza Border</image:title>
      <image:caption>white-golden-dyeable-designer-organza-border</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-golden-dyeable-designer-embroidered-organza-border</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220417_151520_compressed.jpg?v=1659353946</image:loc>
      <image:title>White Golden Dyeable Designer Embroidered Organza Border</image:title>
      <image:caption>white-golden-dyeable-designer-embroidered-organza-border</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-golden-dyeable-designer-organza-lace</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220417_152612_compressed.jpg?v=1659354033</image:loc>
      <image:title>White Golden Dyeable Designer Organza Lace</image:title>
      <image:caption>white-golden-dyeable-designer-organza-lace</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-opaque-spherical-glass-beads-8mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/672.png?v=1746427477</image:loc>
      <image:title>Yellow Opaque Spherical Glass Beads - 8mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-purple-and-white-viscose-muslin-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/dark_purple_lines_viscose_muslin_fabric_1.jpg?v=1659960917</image:loc>
      <image:title>Dark Purple And White Viscose Muslin Silk Fabric</image:title>
      <image:caption>dark-purple-and-white-viscose-muslin-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-opaque-round-rocaille-glass-seed-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/704.png?v=1659960979</image:loc>
      <image:title>Yellow Opaque Round Rocaille Glass Seed Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-opaque-oval-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/641.png?v=1748249062</image:loc>
      <image:title>Yellow Opaque Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/magenta-and-white-dots-viscose-muslin-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/white_big_dots_dark_pink_viscose_muslin_fabric_1.jpg?v=1659961181</image:loc>
      <image:title>Magenta and White Dots Viscose Muslin Fabric</image:title>
      <image:caption>magenta-and-white-dots-viscose-muslin-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-and-golden-floral-motif-blue-viscose-lurex-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/small_floral_motif_blue_viscose_lurex_digital_fabric_1.jpg?v=1659961404</image:loc>
      <image:title>Blue And Golden Floral Motif Blue Viscose Lurex Fabric</image:title>
      <image:caption>blue-and-golden-floral-motif-blue-viscose-lurex-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-lustre-oval-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/623.png?v=1748249066</image:loc>
      <image:title>Yellow Lustre Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-brown-lustre-oval-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/620.png?v=1748249074</image:loc>
      <image:title>Light Brown Lustre Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-drop-opaque-lustre-oval-glass-beads-9x7mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/657.png?v=1748249071</image:loc>
      <image:title>Yellow Drop Opaque Lustre Oval Glass Beads- 9x7mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-transparent-spherical-glass-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/722.png?v=1748249078</image:loc>
      <image:title>White Transparent Spherical Glass Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-rainbow-opaque-round-rocaille-glass-seed-beads-5mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/677.png?v=1659962883</image:loc>
      <image:title>White Rainbow Opaque Round Rocaille Glass Seed Beads-5mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-opaque-spherical-glass-beads-8mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/670.png?v=1746427370</image:loc>
      <image:title>White Opaque Spherical Glass Beads-8mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-opaque-spherical-glass-beads-6mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/662.png?v=1746427392</image:loc>
      <image:title>White Opaque Spherical Glass Beads-6mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-opaque-oval-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/644.png?v=1748249082</image:loc>
      <image:title>White Opaque Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/sky-blue-opaque-round-rocaille-glass-seed-beads-5mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/680.png?v=1659964206</image:loc>
      <image:title>Sky Blue Opaque Round Rocaille Glass Seed Beads-5mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-lustre-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/622.png?v=1748249086</image:loc>
      <image:title>Silver Lustre Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-transparent-spherical-glass-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/721.png?v=1748249094</image:loc>
      <image:title>Red Transparent Spherical Glass Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-transparent-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/634.png?v=1748249090</image:loc>
      <image:title>Red Transparent Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-round-rocaille-glass-seed-beads-11-0-or-2mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/605.png?v=1659964614</image:loc>
      <image:title>Red Round Rocaille Glass Seed Beads- 11/0 or 2mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-opaque-round-rocaille-glass-seed-beads-5mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/678.png?v=1659964635</image:loc>
      <image:title>Red Opaque Round Rocaille Glass Seed Beads-5mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-opaque-round-rocaille-glass-seed-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/705.png?v=1659964663</image:loc>
      <image:title>Red Opaque Round Rocaille Glass Seed Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-opaque-round-rocaille-glass-seed-beads-4mm-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/685.png?v=1659964682</image:loc>
      <image:title>Red Opaque Round Rocaille Glass Seed Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-opaque-oval-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/650.png?v=1748249098</image:loc>
      <image:title>Red Opaque Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-opaque-oval-glass-beads-7x4mm-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/646.png?v=1748249102</image:loc>
      <image:title>Red Opaque Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-lustre-oval-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/616.png?v=1748242922</image:loc>
      <image:title>Red Lustre Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-drop-opaque-lustre-glass-beads-9x7mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/658.png?v=1748242927</image:loc>
      <image:title>Red Drop Opaque Lustre Glass Beads- 9x7mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-round-rocaille-glass-seed-beads-11-0-or-2mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/611.png?v=1660030085</image:loc>
      <image:title>Pink Round Rocaille Glass Seed Beads- 11/0 or 2mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-round-rocaille-glass-seed-beads-11-0-or-2mm-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/600.png?v=1660030104</image:loc>
      <image:title>Pink Round Rocaille Glass Seed Beads- 11/0 or 2mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peridot-green-round-rocaille-glass-seed-beads-11-0-or-2mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/601.png?v=1660030122</image:loc>
      <image:title>Peridot Green Round Rocaille Glass Seed Beads- 11/0 or 2mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peridot-green-opaque-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/647.png?v=1748242931</image:loc>
      <image:title>Peridot Green Opaque Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-round-rocaille-glass-seed-beads-11-0-or-2mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/597.png?v=1660030172</image:loc>
      <image:title>Peach Round Rocaille Glass Seed Beads -11/0 or 2mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/patel-green-opaque-round-rocaille-glass-seed-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/706.png?v=1660030189</image:loc>
      <image:title>Pastel Green Opaque Round Rocaille Glass Seed Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/orange-round-rocaille-glass-seed-beads-11-0-or-2mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/603.png?v=1660030701</image:loc>
      <image:title>Orange Round Rocaille Glass Seed Beads- 11/0 or 2mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pastel-blue-opaque-round-rocaille-glass-seed-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/703.png?v=1660030717</image:loc>
      <image:title>Pastel Blue Opaque Round Rocaille Glass Seed Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/orange-transparent-spherical-glass-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/724.png?v=1748242935</image:loc>
      <image:title>Orange Transparent Spherical Glass Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/orange-opaque-spherical-glass-beads-6mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/667.png?v=1746429554</image:loc>
      <image:title>Orange Opaque Spherical Glass Beads- 6mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/orange-opaque-oval-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/639.png?v=1660030789</image:loc>
      <image:title>Orange Opaque Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/orange-lustre-oval-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/617.png?v=1748242939</image:loc>
      <image:title>Orange Lustre Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/orange-drop-opaque-lustre-glass-beads-9x7mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/659.png?v=1748242943</image:loc>
      <image:title>Orange Drop Opaque Lustre Glass Beads- 9x7mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/olive-green-opaque-round-rocaille-glass-seed-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/690.png?v=1660030922</image:loc>
      <image:title>Olive Green Opaque Round Rocaille Glass Seed Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/olive-green-opaque-oval-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/643.png?v=1748242947</image:loc>
      <image:title>Olive Green Opaque Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/off-white-round-rocaille-glass-seed-beads-11-0-or-2mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/599.png?v=1660039277</image:loc>
      <image:title>Off White Round Rocaille Glass Seed Beads- 11/0 or 2mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/off-white-transparent-spherical-glass-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/717.png?v=1660039291</image:loc>
      <image:title>Off White Transparent Spherical Glass Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/off-white-lustre-oval-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/631.png?v=1748242952</image:loc>
      <image:title>Off White Lustre Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/navy-blue-opaque-oval-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/642.png?v=1748242960</image:loc>
      <image:title>Navy Blue Opaque Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/maroon-transparent-spherical-glass-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/723.png?v=1748242965</image:loc>
      <image:title>Maroon Transparent Spherical Glass Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/maroon-transparent-oval-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/635.png?v=1748242969</image:loc>
      <image:title>Maroon Transparent Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/maroon-opaque-round-rocaille-glass-seed-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/692.png?v=1660041743</image:loc>
      <image:title>Maroon Opaque Round Rocaille Glass Seed Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-red-drop-opaque-lustre-glass-beads-9x7mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/660.png?v=1748242973</image:loc>
      <image:title>Light Red Drop Opaque Lustre Glass Beads- 9x7mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-pink-round-rocaille-glass-seed-beads-11-0-or-2mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/615.png?v=1660041815</image:loc>
      <image:title>Light Pink Round Rocaille Glass Seed Beads- 11/0 or 2mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-orange-round-rocaille-glass-seed-beads-11-0-or-2mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/612.png?v=1660041847</image:loc>
      <image:title>Light Orange Round Rocaille Glass Seed Beads- 11/0 or 2mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-grey-opaque-round-rocaille-glass-seed-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/683.png?v=1660041865</image:loc>
      <image:title>Light Gray Opaque Round Rocaille Glass Seed Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-grey-lustre-oval-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/632.png?v=1748242977</image:loc>
      <image:title>Light Gray Lustre Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-green-opaque-round-rocaille-glass-seed-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/687.png?v=1660041907</image:loc>
      <image:title>Light Green Opaque Round Rocaille Glass Seed Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-green-opaque-oval-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/652.png?v=1748242982</image:loc>
      <image:title>Light Green Opaque Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dobby-stripes-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/img_20241212_185253_519193e4-34c4-4293-9798-44efedcf9376.jpg?v=1747549358</image:loc>
      <image:title>Blue Motifs Cotton Dobby Fabric</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-peach-and-white-floral-motif-peach-viscose-muslin-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/white_floral_motif_peach_viscose_muslin_fabric_2.jpg?v=1709195178</image:loc>
      <image:title>Dark Peach And White Floral Motif Peach Viscose Muslin Fabric</image:title>
      <image:caption>dark-peach-and-white-floral-motif-peach-viscose-muslin-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-round-rocaille-glass-seed-beads-11-0-or-2mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/608.png?v=1660305292</image:loc>
      <image:title>Yellow Round Rocaille Glass Seed Beads- 11/0 or 2mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-green-lustre-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/629.png?v=1748242987</image:loc>
      <image:title>Light Green Lustre Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-golden-round-rocaille-glass-seed-beads-11-0-or-2mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/607.png?v=1660305347</image:loc>
      <image:title>Light Golden Round Rocaille Glass Seed Beads- 11/0 or 2mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-brown-transparent-spherical-glass-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/720.png?v=1748243001</image:loc>
      <image:title>Light Brown Transparent Spherical Glass Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-blue-round-rocaille-glass-seed-beads-11-0-or-2mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/602.png?v=1660305388</image:loc>
      <image:title>Light Blue Round Rocaille Glass Seed Beads- 11/0 or 2mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-blue-opaque-spherical-glass-beads-8mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/673.png?v=1746433671</image:loc>
      <image:title>Light Blue Opaque Spherical Glass Beads-8mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-blue-opaque-spherical-glass-beads-6mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/666.png?v=1746433656</image:loc>
      <image:title>Light Blue Opaque Spherical Glass Beads - 6mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-blue-opaque-round-rocaille-glass-seed-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/695.png?v=1660305455</image:loc>
      <image:title>Light Blue Opaque Round Rocaille Glass Seed Beads - 4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-blue-opaque-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/649.png?v=1748243005</image:loc>
      <image:title>Light Blue Opaque Oval Glass Beads-7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-blue-lustre-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/633.png?v=1748242996</image:loc>
      <image:title>Light Blue Lustre Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-blue-lustre-glass-beads-7x4mm-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/621.png?v=1748242991</image:loc>
      <image:title>Light Blue Lustre Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/jet-black-opaque-round-rocaille-glass-seed-beads-5mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/681.png?v=1660306506</image:loc>
      <image:title>Jet Black Opaque Round Rocaille Glass Seed Beads-5mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/jet-black-opaque-round-rocaille-glass-seed-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/714.png?v=1660306522</image:loc>
      <image:title>Jet Black Opaque Round Rocaille Glass Seed Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/gunmetal-grey-opaque-round-rocaille-glass-seed-beads-5mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/676.png?v=1660306557</image:loc>
      <image:title>Gunmetal Grey Opaque Round Rocaille Glass Seed Beads-5mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/gunmetal-grey-lustre-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/630.png?v=1748243009</image:loc>
      <image:title>Gunmetal Gray Lustre Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/grey-round-rocaille-glass-seed-beads-11-0-or-2mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/606.png?v=1660306593</image:loc>
      <image:title>Gray Round Rocaille Glass Seed Beads- 11/0 or 2mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/grey-rainbow-opaque-round-rocaille-glass-seed-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/701.png?v=1660306605</image:loc>
      <image:title>Gray Rainbow Opaque Round Rocaille Glass Seed Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/grey-opaque-round-rocaille-glass-seed-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/688.png?v=1660306618</image:loc>
      <image:title>Gray Opaque Round Rocaille Glass Seed Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/grey-lustre-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/624.png?v=1748243014</image:loc>
      <image:title>Gray Lustre Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-round-rocaille-glass-seed-beads-11-0-or-2mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/609.png?v=1660306649</image:loc>
      <image:title>Green Round Rocaille Glass Seed Beads- 11/0 or 2mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-opaque-spherical-glass-beads-8mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/674.png?v=1746433795</image:loc>
      <image:title>Green Opaque Spherical Glass Beads-8mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-opaque-round-rocaille-glass-seed-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/709.png?v=1660307367</image:loc>
      <image:title>Green Opaque Round Rocaille Glass Seed Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-lustre-oval-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/627.png?v=1748243018</image:loc>
      <image:title>Green Lustre Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-round-rocaille-glass-seed-beads-11-0-or-2mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/604.png?v=1660307399</image:loc>
      <image:title>Uni Golden Round Rocaille Glass Seed Beads- 11/0 or 2mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-lustre-oval-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/618.png?v=1748243023</image:loc>
      <image:title>Golden Lustre Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dull-green-round-rocaille-glass-seed-beads-11-0-or-2mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/613.png?v=1660307431</image:loc>
      <image:title>Dull Green Round Rocaille Glass Seed Beads- 11/0 or 2mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/deep-red-opaque-round-rocaille-glass-seed-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/715.png?v=1660307447</image:loc>
      <image:title>Deep Red Opaque Round Rocaille Glass Seed Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/deep-orange-opaque-spherical-glass-beads-6mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/668.png?v=1746434288</image:loc>
      <image:title>Deep Orange Opaque Spherical Glass Beads-6mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/deep-orange-opaque-round-rocaille-glass-seed-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/712.png?v=1660307490</image:loc>
      <image:title>Deep Orange Opaque Round Rocaille Glass Seed Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/deep-grey-opaque-round-rocaille-glass-seed-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/713.png?v=1660307505</image:loc>
      <image:title>Deep Gray Opaque Round Rocaille Glass Seed Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/deep-blue-opaque-round-rocaille-glass-seed-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/708.png?v=1660307517</image:loc>
      <image:title>Deep Blue Opaque Round Rocaille Glass Seed Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-red-opaque-round-rocaille-glass-seed-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/686.png?v=1660310005</image:loc>
      <image:title>Dark Red Opaque Round Rocaille Glass Seed Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-red-drop-opaque-lustre-glass-beads-9x7mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/655.png?v=1748243028</image:loc>
      <image:title>Dark Red Drop Opaque Lustre Glass Beads- 9x7mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-orange-opaque-round-rocaille-glass-seed-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/699.png?v=1660310071</image:loc>
      <image:title>Dark Orange Opaque Round Rocaille Glass Seed Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-grey-opaque-oval-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/640.png?v=1748243032</image:loc>
      <image:title>Dark Gray Opaque Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-green-transparent-spherical-glass-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/719.png?v=1748243041</image:loc>
      <image:title>Dark Green Transparent Spherical Glass Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-green-transparent-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/638.png?v=1746434176</image:loc>
      <image:title>Dark Green Transparent Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-green-round-rocaille-glass-seed-beads-11-0-or-2mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/598.png?v=1660310165</image:loc>
      <image:title>Dark Green Round Rocaille Glass Seed Beads- 11/0 or 2mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-green-opaque-round-rocaille-glass-seed-beads-5mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/682.png?v=1660310867</image:loc>
      <image:title>Dark Green Opaque Round Rocaille Glass Seed Beads-5mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-green-opaque-round-rocaille-glass-seed-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/702.png?v=1660310881</image:loc>
      <image:title>Dark Green Opaque Round Rocaille Glass Seed Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-blue-opaque-spherical-glass-beads-6mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/664.png?v=1746434600</image:loc>
      <image:title>Dark Blue Opaque Spherical Glass Beads-6mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-blue-opaque-spherical-glass-beads-8mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/675.png?v=1746434350</image:loc>
      <image:title>Dark Blue Opaque Spherical Glass Beads- 8mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-blue-opaque-round-rocaille-glass-seed-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/684.png?v=1660310943</image:loc>
      <image:title>Dark Blue Opaque Round Rocaille Glass Seed Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-blue-opaque-oval-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/651.png?v=1748243049</image:loc>
      <image:title>Dark Blue Opaque Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cream-opaque-round-rocaille-glass-seed-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/693.png?v=1660310991</image:loc>
      <image:title>Cream Opaque Round Rocaille Glass Seed Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/brown-transparent-oval-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/637.png?v=1748243053</image:loc>
      <image:title>Brown Transparent Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/bright-red-round-rocaille-glass-seed-beads-11-0-or-2mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/614.png?v=1660311865</image:loc>
      <image:title>Bright Red Round Rocaille Glass Seed Beads- 11/0 or 2mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/bright-red-opaque-round-rocaille-glass-seed-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/697.png?v=1660311881</image:loc>
      <image:title>Bright Red Opaque Round Rocaille Glass Seed Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/bright-red-lustre-oval-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/619.png?v=1748243057</image:loc>
      <image:title>Bright Red Lustre Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/bright-orange-opaque-round-rocaille-glass-seed-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/710.png?v=1660311933</image:loc>
      <image:title>Bright Orange Opaque Round Rocaille Glass Seed Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/bright-orange-opaque-oval-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/648.png?v=1748243062</image:loc>
      <image:title>Bright Orange Opaque Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-transparent-oval-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/636.png?v=1748243070</image:loc>
      <image:title>Blue Transparent Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-round-rocaille-glass-seed-beads-11-0-or-2mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/610.png?v=1660311988</image:loc>
      <image:title>Blue Round Rocaille Glass Seed Beads- 11/0 or 2mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-opaque-round-rocaille-glass-seed-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/691.png?v=1660311999</image:loc>
      <image:title>Blue Opaque Round Rocaille Glass Seed Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-opaque-oval-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/653.png?v=1748243075</image:loc>
      <image:title>Blue Opaque Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-rainbow-opaque-round-rocaille-glass-seed-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/700.png?v=1660312686</image:loc>
      <image:title>Black Rainbow Opaque Round Rocaille Glass Seed Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-opaque-spherical-glass-beads-6mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/665.png?v=1746437579</image:loc>
      <image:title>Black Opaque Spherical Glass Beads-6mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-opaque-round-rocaille-glass-seed-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/689.png?v=1660312727</image:loc>
      <image:title>Black Opaque Round Rocaille Glass Seed Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-opaque-oval-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/645.png?v=1748243080</image:loc>
      <image:title>Black Opaque Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-lustre-opaque-round-rocaille-glass-seed-beads-4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/694.png?v=1660312774</image:loc>
      <image:title>Black Lustre Opaque Round Rocaille Glass Seed Beads-4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-lustre-oval-glass-beads-7x4mm</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/626.png?v=1748243084</image:loc>
      <image:title>Black Lustre Oval Glass Beads- 7x4mm</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/wood-brown-plain-bangalore-raw-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/img_9725.jpg?v=1762749852</image:loc>
      <image:title>Light Brown Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>wood-brown-plain-bangalore-raw-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-and-white-square-dots-viscose-muslin-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/white_square_dots_pink_viscose_muslin_fabric_1.jpg?v=1660740334</image:loc>
      <image:title>Pink  And White Square Dots Viscose Muslin Silk Fabric</image:title>
      <image:caption>pink-and-white-square-dots-viscose-muslin-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-and-white-florals-viscose-muslin-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/white_florals_brick_pink_viscose_muslin_fabric_1.jpg?v=1660740520</image:loc>
      <image:title>Pink And White Florals Viscose Muslin Silk Fabric</image:title>
      <image:caption>pink-and-white-florals-viscose-muslin-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/orange-red-and-ivory-floral-viscose-lurex-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/big_floral_dark_red_orange_viscose_lurex_fabric_1.jpg?v=1660740954</image:loc>
      <image:title>Orange Red and Ivory Floral Viscose Lurex Fabric</image:title>
      <image:caption>orange-red-and-ivory-floral-viscose-lurex-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/maroon-golden-gota-patti-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220808_183917__01_compressed.jpg?v=1660820120</image:loc>
      <image:title>Maroon Golden Gota Patti Embroidered Chanderi Fabric</image:title>
      <image:caption>maroon-golden-gota-patti-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-green-plaid-check-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/img_20240921_104715.jpg?v=1764678705</image:loc>
      <image:title>Multicolor Checks Plaid Cotton Yarn Dyed Fabric</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multi-color-cotton-stripe-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/img_20241225_185452.jpg?v=1773659826</image:loc>
      <image:title>Multicolor Stripes Cotton Fabric</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/navy-blue-silver-sequins-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220808_165528__01_compressed.jpg?v=1660903454</image:loc>
      <image:title>Navy Blue Silver Sequins Embroidered Chanderi Fabric</image:title>
      <image:caption>navy-blue-silver-sequins-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/orange-with-blue-thread-silver-sequins-embroidery-work-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220808_161803_compressed.jpg?v=1660903703</image:loc>
      <image:title>Pink With Blue Thread &amp; Silver Sequins Embroidery Work Chanderi Fabric</image:title>
      <image:caption>orange-with-blue-thread-silver-sequins-embroidery-work-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-with-silver-sequins-and-yellow-thread-embroidery-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220808_161606_compressed.jpg?v=1660903874</image:loc>
      <image:title>Peach With Silver Sequins And  Yellow Thread Embroidery Chanderi Fabric</image:title>
      <image:caption>peach-with-silver-sequins-and-yellow-thread-embroidery-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/mint-green-white-thread-chikankari-embroidered-georgette</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220516_172141__01_compressed.jpg?v=1660905888</image:loc>
      <image:title>Mint Green White Thread Chikankari Embroidered Georgette</image:title>
      <image:caption>mint-green-white-thread-chikankari-embroidered-georgette</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/grey-white-chikankari-embroidered-georgette-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220516_170833_compressed.jpg?v=1660906092</image:loc>
      <image:title>Grey White Chikankari Embroidered Georgette Fabric</image:title>
      <image:caption>grey-white-chikankari-embroidered-georgette-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/baby-pink-chikankari-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220804_173654_compressed.jpg?v=1774143053</image:loc>
      <image:title>Baby Pink Chikankari Embroidered Chanderi Fabric</image:title>
      <image:caption>baby-pink-chikankari-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/maroon-with-golden-sequins-and-dori-floral-motifs-taffeta-silk</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220801_133455_compressed.jpg?v=1660907730</image:loc>
      <image:title>Maroon With Golden Sequins And Dori Floral Motifs Taffeta Silk</image:title>
      <image:caption>maroon-with-golden-sequins-and-dori-floral-motifs-taffeta-silk</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/slate-grey-silver-sequins-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220804_175759__01_compressed.jpg?v=1660908468</image:loc>
      <image:title>Slate Grey Silver Sequins Embroidered Chanderi Fabric</image:title>
      <image:caption>slate-grey-silver-sequins-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/magenta-with-golden-banarsi-checks-and-double-sided-border-organza</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220730_180053__01_compressed.jpg?v=1660909471</image:loc>
      <image:title>Magenta With Golden Banarsi Checks and Double Sided Border Organza</image:title>
      <image:caption>magenta-with-golden-banarsi-checks-and-double-sided-border-organza</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/olive-green-glaze-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220805_134515_compressed.jpg?v=1671426660</image:loc>
      <image:title>Olive Green Glaze Cotton Fabric</image:title>
      <image:caption>olive-green-glaze-cotton-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/light-blue-glaze-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220805_132407_compressed.jpg?v=1660909853</image:loc>
      <image:title>Light Blue Glaze Cotton Fabric</image:title>
      <image:caption>light-blue-glaze-cotton-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-taffeta-silk-golden-bird-designer-handwork-patch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220801_161115_compressed.jpg?v=1660910037</image:loc>
      <image:title>Black Taffeta Silk Golden Bird Designer Handwork Patch</image:title>
      <image:caption>black-taffeta-silk-golden-bird-designer-handwork-patch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/lemon-yellow-linen-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220802_170808_compressed.jpg?v=1757671721</image:loc>
      <image:title>Yellow Linen Fabric</image:title>
      <image:caption>lemon-yellow-linen-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cream-spherical-glass-pearl-beads-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/BWGP-029.jpg?v=1660984128</image:loc>
      <image:title>Cream Spherical Glass Pearl Beads</image:title>
      <image:caption>cream-spherical-glass-pearl-beads-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cream-oval-glass-pearl-beads-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/BWGP-028.jpg?v=1660984952</image:loc>
      <image:title>Cream Oval Glass Pearl Beads</image:title>
      <image:caption>cream-oval-glass-pearl-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cream-spherical-glass-pearl-beads-3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/BWGP-006.jpg?v=1660985421</image:loc>
      <image:title>CREAM SPHERICAL GLASS PEARL BEADS</image:title>
      <image:caption>cream-spherical-glass-pearl-beads-3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cream-spherical-glass-pearl-beads-4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/BWGP-001.jpg?v=1660985490</image:loc>
      <image:title>CREAM SPHERICAL GLASS PEARL BEADS</image:title>
      <image:caption>cream-spherical-glass-pearl-beads-4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/saffron-orange-chanderi-with-thread-and-golden-sequins-embroidered-motifs-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220808_162109__01__01_compressed.jpg?v=1660988769</image:loc>
      <image:title>Saffron Orange Chanderi With Thread And Golden Sequins Embroidered Motifs Fabric</image:title>
      <image:caption>saffron-orange-chanderi-with-thread-and-golden-sequins-embroidered-motifs-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/mint-green-chikankari-georgette-with-golden-gota-patti-embroidery</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220609_172824_compressed.jpg?v=1660991338</image:loc>
      <image:title>Mint Green Chikankari Georgette With Golden Gota Patti Embroidery</image:title>
      <image:caption>mint-green-chikankari-georgette-with-golden-gota-patti-embroidery</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/precut-1-5-meters-blue-net-with-silver-dori-embroidery</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220803_175111_compressed.jpg?v=1660991869</image:loc>
      <image:title>Precut 1.5 Meters Blue Net With Silver Dori Embroidery</image:title>
      <image:caption>precut-1-5-meters-blue-net-with-silver-dori-embroidery</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-silver-sequins-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220804_174550_compressed.jpg?v=1660992000</image:loc>
      <image:title>Peach Silver sequins Embroidered Chanderi Fabric</image:title>
      <image:caption>peach-silver-sequins-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-organza-with-motifs-organza-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220804_181118_compressed.jpg?v=1660992286</image:loc>
      <image:title>Pink Organza With Motifs Organza Fabric</image:title>
      <image:caption>pink-organza-with-motifs-organza-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/bright-peach-with-silver-embroidered-sequins-work-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220804_183342__01_compressed.jpg?v=1660992486</image:loc>
      <image:title>Bright Peach With Silver Embroidered Sequins Work Chanderi  Fabric</image:title>
      <image:caption>bright-peach-with-silver-embroidered-sequins-work-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/precut-2-15-meters-black-with-grey-dori-embroidery-and-salloped-edges-organza-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220808_145951_compressed.jpg?v=1660992923</image:loc>
      <image:title>Precut  2.15 Meters Black  With Grey Dori Embroidery And Salloped Edges Organza Fabric</image:title>
      <image:caption>precut-2-15-meters-black-with-grey-dori-embroidery-and-salloped-edges-organza-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-designer-aari-needles</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/GREEN1.jpg?v=1660999102</image:loc>
      <image:title>Green Designer Aari Needles</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-designer-aari-needles</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/GOLDEN1.jpg?v=1660999183</image:loc>
      <image:title>Golden Designer Aari Needles</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/combo-pack-of-20-aari-needles-designer</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2_b08a8506-5af4-40e2-a0c6-57e89595474b.jpg?v=1660999409</image:loc>
      <image:title>Combo Pack of 40 Aari Needles (Multi Colour)</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-pearl-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_9908.jpg?v=1661161736</image:loc>
      <image:title>White Pearl Czech Glass Beads</image:title>
      <image:caption>white-pearl-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-black-with-cube-design-metal-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/7_af086a9b-063e-4988-aa37-13fa10d8f102.png?v=1661238398</image:loc>
      <image:title>Golden Black With Cube Design Metal Buttons</image:title>
      <image:caption>golden-black-with-cube-design-metal-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-blue-with-cube-design-metal-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/5_492fd8a7-d6d1-477d-9a77-89121540edc9.png?v=1661239277</image:loc>
      <image:title>Golden Blue With Cube Design Metal Buttons</image:title>
      <image:caption>golden-blue-with-cube-design-metal-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-green-with-cube-design-metal-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1_e50cef32-632a-415d-8cb9-04a6817d5b87.png?v=1661239768</image:loc>
      <image:title>Golden Green With Cube Design Metal Buttons</image:title>
      <image:caption>golden-green-with-cube-design-metal-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-maroon-with-cube-design-metal-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/3_477faea8-2a24-427b-8b94-174a125d7a1b.png?v=1661240923</image:loc>
      <image:title>Golden Maroon With Cube Design Metal Buttons</image:title>
      <image:caption>golden-maroon-with-cube-design-metal-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-multicolor-designer-metal-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/3_98f1b52a-b39e-4eb8-8c75-fe0eb131b79e.png?v=1661241104</image:loc>
      <image:title>Red Multicolor Designer Metal Buttons</image:title>
      <image:caption>red-multicolor-designer-metal-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/lemon-yellow-thread-zari-embroidered-border</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/18C.png?v=1743576486</image:loc>
      <image:title>Lemon Yellow Thread &amp; Zari Embroidered Border</image:title>
      <image:caption>lemon-yellow-thread-zari-embroidered-border</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/assorted-multicolour-acrylic-chalk-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/buttons.jpg?v=1661242038</image:loc>
      <image:title>Assorted Multicolour Acrylic Chalk Buttons</image:title>
      <image:caption>assorted-multicolour-acrylic-chalk-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-stylish-designer-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1_8c37e6f5-cba4-4fce-8417-9aa1a2fbbdfd.png?v=1661242167</image:loc>
      <image:title>Golden Stylish Designer Buttons</image:title>
      <image:caption>golden-stylish-designer-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-dotted-design-metal-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/4_26fa19ee-4cf5-4041-a3fc-434b96db3bbe.png?v=1661242219</image:loc>
      <image:title>Green Dotted Design Metal Buttons</image:title>
      <image:caption>green-dotted-design-metal-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-dotted-design-metal-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1_de95c1f5-b08b-4958-9d8b-6f785c50dee7.png?v=1661242277</image:loc>
      <image:title>Black Dotted Design Metal Buttons</image:title>
      <image:caption>black-dotted-design-metal-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-golden-flower-design-metal-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/4_a3cbd117-5328-4390-9ad9-b28a0c2932df.png?v=1661242326</image:loc>
      <image:title>Green Golden Flower Design Metal Buttons</image:title>
      <image:caption>green-golden-flower-design-metal-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-skeleton-design-chain-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/brooch-thumbnail-_281_29.png?v=1757865210</image:loc>
      <image:title>Silver Skeleton Design Chain Brooch</image:title>
      <image:caption>silver-skeleton-design-chain-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-red-stone-studded-designer-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/17_0dee11ad-0a9e-4406-b947-f4b7bbe9b2d0.png?v=1661242849</image:loc>
      <image:title>Silver Red Stone Studded Designer Brooch</image:title>
      <image:caption>silver-red-stone-studded-designer-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-king-style-designer-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/15_9385164a-56ee-4a76-8708-4ef81739a033.png?v=1661243025</image:loc>
      <image:title>Golden King Style Designer Brooch</image:title>
      <image:caption>golden-king-style-designer-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-stone-studded-designer-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/14_0528ef20-78c0-4eac-84b4-59454a6f023a.png?v=1661243070</image:loc>
      <image:title>Golden Stone Studded Designer Brooch</image:title>
      <image:caption>golden-stone-studded-designer-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-and-silver-color-leaf-designer-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/10_6c4198cf-2fb1-458f-9df2-a93d08f23680.png?v=1661243356</image:loc>
      <image:title>Golden and Silver Color Leaf Designer Brooch</image:title>
      <image:caption>golden-and-silver-color-leaf-designer-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-eagle-bird-with-axe-designer-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9_fce20ed0-a5f9-4866-bf91-d760ac3802eb.png?v=1661243466</image:loc>
      <image:title>Golden Eagle Bird with Axe Designer Brooch</image:title>
      <image:caption>golden-eagle-bird-with-axe-designer-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-star-with-feather-designer-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/brooch-thumbnail-_281_29_a2652a92-ec4e-48d6-8b8b-30c7cd7907b2.png?v=1661243522</image:loc>
      <image:title>Golden Star with Feather Designer Brooch</image:title>
      <image:caption>golden-star-with-feather-designer-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-star-designer-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/6_572c6cf7-2645-4cdf-8689-2b217ec28051.png?v=1661248897</image:loc>
      <image:title>Golden Star Designer Brooch</image:title>
      <image:caption>golden-star-designer-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-lion-face-chain-designer-brooch</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2_377bbe3e-99ac-4230-ad11-6dbfcdafd179.png?v=1661248980</image:loc>
      <image:title>Silver Lion Face &amp; Chain Designer Brooch</image:title>
      <image:caption>silver-lion-face-chain-designer-brooch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/brown-polka-dots-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/114b.jpg?v=1753087861</image:loc>
      <image:title>Brown Polka Dots Cotton Fabric</image:title>
      <image:caption>brown-polka-dots-cotton-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-maroon-designer-metal-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/5_8dafe992-4061-46bd-b61d-f9439f87703b.png?v=1661423940</image:loc>
      <image:title>Golden Maroon Designer Metal Buttons</image:title>
      <image:caption>golden-maroon-designer-metal-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-black-designer-metal-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/4_97fd37e7-29aa-4b32-8852-70c80faf40e8.png?v=1661424019</image:loc>
      <image:title>Golden Black Designer Metal Buttons</image:title>
      <image:caption>golden-black-designer-metal-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-blue-stone-studded-designer-metal-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2_1d478a62-24da-430f-8abc-6042302101e0.png?v=1661424051</image:loc>
      <image:title>Golden Blue Stone Studded Designer Metal Buttons</image:title>
      <image:caption>golden-blue-stone-studded-designer-metal-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-lion-face-designer-metal-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1_c49b216d-63f3-442c-b957-8a8cc767f0f0.png?v=1661424348</image:loc>
      <image:title>Golden Lion Face Designer Metal Buttons</image:title>
      <image:caption>golden-lion-face-designer-metal-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-black-lion-face-designer-metal-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1_c016e2b6-8f8b-42d3-8074-115724b85cb5.png?v=1661424381</image:loc>
      <image:title>Golden Black Lion Face Designer Metal Buttons</image:title>
      <image:caption>golden-black-lion-face-designer-metal-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-floral-design-metal-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1_fc9ac882-3f70-4129-a06a-8828564b8335.png?v=1661424452</image:loc>
      <image:title>Blue Floral Design Metal Buttons</image:title>
      <image:caption>blue-floral-design-metal-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-traditional-design-metal-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1_bb050477-56ca-43ad-bf44-b3d2bcbec770.png?v=1661424498</image:loc>
      <image:title>Golden Traditional Design Metal Buttons</image:title>
      <image:caption>golden-traditional-design-metal-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-black-chakra-designer-metal-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1_7dce277f-7a0a-49c8-adf9-8207e7c99d53.png?v=1661425922</image:loc>
      <image:title>Golden Black Chakra Designer Metal Buttons</image:title>
      <image:caption>golden-black-chakra-designer-metal-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-maroon-chakra-designer-metal-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/3_af81f503-1704-41b8-b800-1861a292125f.png?v=1661426082</image:loc>
      <image:title>Golden Maroon Chakra Designer Metal Buttons</image:title>
      <image:caption>golden-maroon-chakra-designer-metal-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-blue-chakra-designer-metal-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/5_ebf6533a-dbd1-474f-8e5d-edb2c270ec3c.png?v=1661426112</image:loc>
      <image:title>Golden Blue Chakra Designer Metal Buttons</image:title>
      <image:caption>golden-blue-chakra-designer-metal-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-blue-traditional-design-metal-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/4_c5a70c74-8faf-4948-bb78-4b5a6bedafbe.png?v=1661426223</image:loc>
      <image:title>Golden Blue Traditional Design Metal Buttons</image:title>
      <image:caption>golden-blue-traditional-design-metal-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-green-traditional-design-metal-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2_694addf7-8af0-4fb8-8e9c-a20d28c463b5.png?v=1661426254</image:loc>
      <image:title>Golden Green Traditional Design Metal Button</image:title>
      <image:caption>golden-green-traditional-design-metal-button</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-red-traditional-design-metal-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1_d5ff60ad-7445-48b0-8e35-1fda08eaa534.png?v=1661426280</image:loc>
      <image:title>Golden Red Traditional Design Metal Button</image:title>
      <image:caption>golden-red-traditional-design-metal-button</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-blue-unique-design-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/4_841bc38f-a3fb-4c1a-a0c1-0510dfbd2bed.png?v=1661426447</image:loc>
      <image:title>Golden Blue Unique Design Buttons</image:title>
      <image:caption>golden-blue-unique-design-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-maroon-unique-design-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/2_dfbd9ee0-20f0-48cf-b2db-bd924f2629fd.png?v=1661426480</image:loc>
      <image:title>Golden Maroon Unique Design Buttons</image:title>
      <image:caption>golden-maroon-unique-design-buttons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-multicolor-christmas-tree-wooden-embellishment</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-189-3.jpg?v=1661430644</image:loc>
      <image:title>Red Multicolor Christmas Tree Wooden Embellishment</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-multicolor-giraffe-wooden-embellishment</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-160-3.jpg?v=1661432098</image:loc>
      <image:title>Red Multicolor Giraffe Wooden Embellishment</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-multicolor-butterfly-wooden-embellishment</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-164-2.jpg?v=1661433332</image:loc>
      <image:title>Yellow Multicolor Butterfly Wooden Embellishment</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/precut-2-35-metres-black-multicolor-peacock-motifs-and-golden-dori-work-with-scalloped-edges-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220808_155107__01_compressed.jpg?v=1661498070</image:loc>
      <image:title>Precut 2.35 Metres Black Multicolor Peacock Motifs and Golden Dori Work with Scalloped Edges Chanderi Fabric</image:title>
      <image:caption>precut-2-35-metres-black-multicolor-peacock-motifs-and-golden-dori-work-with-scalloped-edges-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-golden-stripes-heavy-acrylic-jacquard-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/110a.jpg?v=1753087860</image:loc>
      <image:title>Black Golden Stripes Heavy Acrylic Jacquard Fabric</image:title>
      <image:caption>black-golden-stripes-heavy-acrylic-jacquard-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-and-green-checks-teddy-bear-plastic-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-432-2.jpg?v=1661511121</image:loc>
      <image:title>White and Green Checks Teddy Bear Wooden Buttons</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-plain-tesla-premium-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220723_134906_compressed.jpg?v=1671426585</image:loc>
      <image:title>White Plain Tesla Premium Cotton Fabric</image:title>
      <image:caption>white-plain-tesla-premium-cotton-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-multicolored-chevron-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20211220_171722_compressed.jpg?v=1661580867</image:loc>
      <image:title>White Multicolored Chevron Embroidered Chanderi Fabric</image:title>
      <image:caption>white-multicolored-chevron-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/lime-green-floral-motifs-printed-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220730_161103_compressed.jpg?v=1661580935</image:loc>
      <image:title>Lime Green Floral Motifs Printed Chanderi Fabric</image:title>
      <image:caption>lime-green-floral-motifs-printed-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/lemon-yellow-sustainable-linen-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220815_151913__01_compressed.jpg?v=1675068272</image:loc>
      <image:title>Lemon Yellow Sustainable Linen Fabric</image:title>
      <image:caption>lemon-yellow-sustainable-linen-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/baby-pink-sustainable-premium-linen-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220814_160655_compressed.jpg?v=1661582278</image:loc>
      <image:title>Baby Pink Sustainable Premium Linen Fabric</image:title>
      <image:caption>baby-pink-sustainable-premium-linen-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-plain-tesla-premium-cotton-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220723_140515__01_compressed.jpg?v=1671426623</image:loc>
      <image:title>Black Plain Tesla Premium Cotton Fabric</image:title>
      <image:caption>black-plain-tesla-premium-cotton-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-dyeable-mono-net-with-golden-sequins-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20211024_133547__01_compressed.jpg?v=1671258078</image:loc>
      <image:title>White Dyeable Mono Net With Golden Sequins Net Fabric</image:title>
      <image:caption>white-dyeable-mono-net-with-golden-sequins-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/lime-green-mirror-work-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20211024_130516__01_compressed.jpg?v=1661587389</image:loc>
      <image:title>Lime Green Mirror Work Embroidered Chanderi Fabric</image:title>
      <image:caption>lime-green-mirror-work-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-self-striped-rayon-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220730_174410_compressed.jpg?v=1747634570</image:loc>
      <image:title>Blue Self Striped Rayon Fabric</image:title>
      <image:caption>blue-self-striped-rayon-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-golden-zari-embroidered-floral-motifs-net</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220728_165852_compressed.jpg?v=1661588055</image:loc>
      <image:title>Peach Golden Zari Embroidered Floral Motifs Net</image:title>
      <image:caption>peach-golden-zari-embroidered-floral-motifs-net</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dyeable-white-chikankari-embroidered-organza-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220721_113041__01_compressed.jpg?v=1661588633</image:loc>
      <image:title>Dyeable White Chikankari Embroidered Organza Fabric</image:title>
      <image:caption>dyeable-white-chikankari-embroidered-organza-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-pearl-glass-beads-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_9979.jpg?v=1661760977</image:loc>
      <image:title>Off- White Pearl Czech Glass Beads</image:title>
      <image:caption>white-pearl-glass-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-pearl-glass-beads-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_9976.jpg?v=1661766299</image:loc>
      <image:title>White Pearl Czech Glass Beads</image:title>
      <image:caption>white-pearl-glass-beads-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-glass-pearl-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_9971.jpg?v=1661766381</image:loc>
      <image:title>Pink Czech Glass Pearl Beads</image:title>
      <image:caption>pink-glass-pearl-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-pearl-glass-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_9967.jpg?v=1661766451</image:loc>
      <image:title>Pink Pearl Czech Glass Beads</image:title>
      <image:caption>pink-pearl-glass-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-glass-pearl-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_9964.jpg?v=1661766799</image:loc>
      <image:title>lite green Czech Glass Pearl  Beads</image:title>
      <image:caption>white-glass-pearl-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/golden-glass-pearl-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_9960.jpg?v=1661766913</image:loc>
      <image:title>Golden Czech Glass Pearl  Beads</image:title>
      <image:caption>golden-glass-pearl-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-glass-pearl-beads-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_9912.jpg?v=1661767123</image:loc>
      <image:title>White Czech Glass Pearl Beads</image:title>
      <image:caption>white-glass-pearl-beads-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-pink-glass-pearl-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_9916.jpg?v=1661767196</image:loc>
      <image:title>Dark Pink Czech Glass Pearl Beads</image:title>
      <image:caption>dark-pink-glass-pearl-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/rose-gold-glass-pearl-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_9919.jpg?v=1661767624</image:loc>
      <image:title>Rose Gold Czech Glass Pearl Beads</image:title>
      <image:caption>rose-gold-glass-pearl-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-glass-pearl-beads-3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_9924.jpg?v=1661767892</image:loc>
      <image:title>White Czech Glass Pearl Beads</image:title>
      <image:caption>white-glass-pearl-beads-3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/off-white-glass-pearl-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_9932.jpg?v=1661768024</image:loc>
      <image:title>Off White Czech Glass Pearl Beads</image:title>
      <image:caption>off-white-glass-pearl-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-pearl-glass-beads-3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_9944.jpg?v=1661771188</image:loc>
      <image:title>White Pearl Czech Glass Beads</image:title>
      <image:caption>white-pearl-glass-beads-3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-pearl-glass-beads-4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_9940.jpg?v=1661776166</image:loc>
      <image:title>White Pearl Czech Glass Beads</image:title>
      <image:caption>white-pearl-glass-beads-4</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cream-glass-pearl-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_9935.jpg?v=1661776459</image:loc>
      <image:title>Cream Czech Glass Pearl  Beads</image:title>
      <image:caption>cream-glass-pearl-beads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/off-white-glass-pearl-beads-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_9956.jpg?v=1661776621</image:loc>
      <image:title>Off White Czech Glass Pearl Beads</image:title>
      <image:caption>off-white-glass-pearl-beads-1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/off-white-glass-pearl-beads-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_9948.jpg?v=1661776697</image:loc>
      <image:title>Off White Czech Glass Pearl Beads</image:title>
      <image:caption>off-white-glass-pearl-beads-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/chocolate-brown-plain-georgette-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/159b.jpg?v=1753087854</image:loc>
      <image:title>Chocolate Brown Plain Georgette Fabric</image:title>
      <image:caption>chocolate-brown-plain-georgette-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-brown-plain-crepe-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/161b.jpg?v=1753087853</image:loc>
      <image:title>Dark Brown Plain Crepe Fabric</image:title>
      <image:caption>dark-brown-plain-crepe-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/deep-brown-plain-crepe-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/160b.jpg?v=1753087852</image:loc>
      <image:title>Deep Brown Plain Crepe Fabric</image:title>
      <image:caption>deep-brown-plain-crepe-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/off-white-loose-weave-cotton-poly-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/153b.jpg?v=1753087851</image:loc>
      <image:title>Off White Loose Weave Cotton Poly Fabric</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/water-golden-plain-polyester-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/150b.jpg?v=1753087847</image:loc>
      <image:title>Water Golden Wrinkled Plain Polyester Fabric</image:title>
      <image:caption>water-golden-plain-polyester-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/cute-feet-2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-53-4.jpg?v=1661947263</image:loc>
      <image:title>Cute Feet 2 hole wooden button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/duck-shape-2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-273.jpg?v=1661947332</image:loc>
      <image:title>Duck Shape 2 hole wooden button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/car-shape-2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-54-3.jpg?v=1661948421</image:loc>
      <image:title>Car Shape 2 hole wooden button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multi-colored-butterfly-shape-2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-766-_284_29.jpg?v=1661948534</image:loc>
      <image:title>Multi Colored Butterfly Shape 2 hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-srawberry-shape-2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-428.jpg?v=1661948630</image:loc>
      <image:title>Green Srawberry Shape 2 Hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicoloured-doll-shape-2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-474-_284_29.jpg?v=1661948963</image:loc>
      <image:title>Multicoloured  Doll Shape 2 Hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-color-knot-shape-2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-755-_281_29.jpg?v=1661949016</image:loc>
      <image:title>Yellow Color Knot shape 2 hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicoloured-cat-shape-2-holes-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-188-3.jpg?v=1661949090</image:loc>
      <image:title>Multicoloured Cat Shape 2 Holes Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-strawberry-shape-2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-483-_282_29.jpg?v=1661949978</image:loc>
      <image:title>Red Strawberry Shape 2 Hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-strawberry-shape-2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-482-_282_29.jpg?v=1661950061</image:loc>
      <image:title>Pink Strawberry Shape 2 Hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-flower-shape-2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-476-_284_29.jpg?v=1661950217</image:loc>
      <image:title>Red Flower Shape 2 Hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/magenta-pink-flower-shape-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-475-_284_29.jpg?v=1661950340</image:loc>
      <image:title>Magenta Pink Flower Shape Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-apple-shape-2-hole-wooden-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-211-_283_29.jpg?v=1661950404</image:loc>
      <image:title>Pink Apple Shape 2 Hole Wooden Buttons</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-thread-and-sequins-embroidered-chanderi-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220821_162834__01_compressed.jpg?v=1662103548</image:loc>
      <image:title>Pink Thread And Sequins Embroidered Chanderi Fabric</image:title>
      <image:caption>pink-thread-and-sequins-embroidered-chanderi-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/precut-dual-shaded-blue-grey-zorba-silk-with-grey-dori-embroidery-work-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/img_20220817_180009_compressed.jpg?v=1662111613</image:loc>
      <image:title>Precut Dual Shaded Blue Grey Zorba Silk With Grey Dori Embroidery Work Fabric</image:title>
      <image:caption>precut-dual-shaded-blue-grey-zorba-silk-with-grey-dori-embroidery-work-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/wooden-round-shape-4-hole-buttons</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-731-32l-6.jpg?v=1662189618</image:loc>
      <image:title>Wooden Round shape 4 hole Buttons</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-line-wooden-4-hole-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-732-32l-5.jpg?v=1662189873</image:loc>
      <image:title>Blue Line wooden 4 hole Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-line-wooden-4-hole-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-733-32l-5.jpg?v=1662189988</image:loc>
      <image:title>Yellow Line Wooden 4 hole Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-wooden-4-hole-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-529-28l-3.jpg?v=1662190393</image:loc>
      <image:title>Pink Wooden 4 Hole Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-wooden-4-hole-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-520-28l-4.jpg?v=1662191023</image:loc>
      <image:title>Yellow Wooden 4 Hole Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-wooden-4-hole-button-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-520-28l-4.webp?v=1662191209</image:loc>
      <image:title>Yellow Wooden 4 Hole Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-wooden-2-hole-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-737-28l-5.jpg?v=1662197905</image:loc>
      <image:title>Pink Wooden 2 Hole Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-wooden-2-hole-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-738-28l-5.jpg?v=1662198112</image:loc>
      <image:title>Blue Wooden 2 Hole Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-wooden-2-hole-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-739-28l-5.jpg?v=1662198199</image:loc>
      <image:title>Yellow Wooden 2 Hole Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-wooden-4-hole-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-517-28l-5.jpg?v=1662198270</image:loc>
      <image:title>Red Wooden 4 Hole Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-and-brown-wooden-4-hole-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-630-28l5.jpg?v=1662198394</image:loc>
      <image:title>Pink and Brown Wooden 4 Hole Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-wooden-4-hole-button-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-624-28l-4.jpg?v=1662198477</image:loc>
      <image:title>Blue Wooden 4 Hole Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/precut-2-metres-pleated-baby-pink-viscose-georgette-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/4b_68b39555-9437-4e57-9466-392d31fac71c.jpg?v=1662718649</image:loc>
      <image:title>Precut 2 Metres Pleated Baby Pink Viscose Georgette Fabric</image:title>
      <image:caption>precut-2-metres-pleated-baby-pink-viscose-georgette-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-white-zari-thread-embroidered-net-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/9b_88859d96-86b0-41fa-b298-f0907bdde9a6.jpg?v=1753087845</image:loc>
      <image:title>Silver White Zari &amp; Thread Embroidered Net Fabric</image:title>
      <image:caption>silver-white-zari-thread-embroidered-net-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/hot-pink-plain-bangalore-raw-silk-fabric-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1_7d76ff0a-2ab7-48ec-9107-697e71c663d5.jpg?v=1756272889</image:loc>
      <image:title>Hot Pink Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>hot-pink-plain-bangalore-raw-silk-fabric-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/parrot-green-plain-bangalore-raw-silk-fabric-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1_a922b007-b2b5-420f-b19f-efd5f2f6fed8.jpg?v=1761546063</image:loc>
      <image:title>Parrot Green Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>parrot-green-plain-bangalore-raw-silk-fabric-2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peach-pink-plain-bangalore-raw-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/img_0161.jpg?v=1760505524</image:loc>
      <image:title>Peach Pink Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>peach-pink-plain-bangalore-raw-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/peacock-blue-plain-bangalore-raw-silk-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1_20b24cee-ca1e-4962-a52b-c797d3dad50a.jpg?v=1756302826</image:loc>
      <image:title>Peacock Blue Plain Bangalore Raw Silk Fabric</image:title>
      <image:caption>peacock-blue-plain-bangalore-raw-silk-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolored-car-shape-22-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-380--4.jpg?v=1662978753</image:loc>
      <image:title>Multicolor Car Shape 2 Hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/red-color-flower-shape-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-242-3.jpg?v=1663054589</image:loc>
      <image:title>Red Color Flower Shape Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-flower-shape-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-240-4.jpg?v=1663054647</image:loc>
      <image:title>Yellow  Flower Shape  Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolored-cat-shape-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-150-4.jpg?v=1663054742</image:loc>
      <image:title>Multicolored  Cat Shape Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-wooden-fancy-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-352-32l-6.jpg?v=1663055048</image:loc>
      <image:title>Multicolor Wooden Fancy Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-2-hole-wooden-fancy-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-343-32l-6.jpg?v=1663055129</image:loc>
      <image:title>Multicolor  2 Hole Wooden Fancy Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multi-colour-2-hole-wooden-fancy-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-340.jpg?v=1663055470</image:loc>
      <image:title>Multi colour 2 Hole Wooden Fancy Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolored-barbie-doll-wooden-fancy-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-346-32l-3.jpg?v=1663055542</image:loc>
      <image:title>Multicolored Barbie Doll  Wooden Fancy Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-barbie-doll-printed-2-hole-wooden-fancy-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-346-32l-4.jpg?v=1663055833</image:loc>
      <image:title>Multicolor Barbie Doll Printed 2 hole Wooden Fancy Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-2-hole-barbie-doll-printed-wooden-fancy-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-579-40l-5.jpg?v=1663055915</image:loc>
      <image:title>Multicolor 2 hole Barbie doll Printed Wooden Fancy Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-hello-kitty-printed-2-hole-wooden-fancy-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-562-40l-6.jpg?v=1663056003</image:loc>
      <image:title>Multicolor Hello Kitty Printed 2 hole Wooden Fancy Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-mickey-mouse-shape-2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-361-4.jpg?v=1663056697</image:loc>
      <image:title>Pink Mickey Mouse Shape 2 Hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-micky-mouse-shape-2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-359-4.jpg?v=1663056926</image:loc>
      <image:title>Blue Micky Mouse Shape 2 Hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-flower-shape-2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-774-2.jpg?v=1663057017</image:loc>
      <image:title>Pink Flower Shape 2 Hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-flower-printed-2-hole-wooden-fancy-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-584-_7B1_7D.jpg?v=1663057108</image:loc>
      <image:title>Multicolor  Flower Printed  2 Hole Wooden Fancy Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-mickey-mouse-printed-2-hole-wooden-fancy-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-366-32l-1.jpg?v=1663057235</image:loc>
      <image:title>Multicolor Mickey Mouse Printed  2 Hole Wooden Fancy Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-wooden-fancy-button-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-275-4.jpg?v=1663057478</image:loc>
      <image:title>Multicolor Wooden Fancy Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/yellow-hand-shape-2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-299-4.jpg?v=1663057554</image:loc>
      <image:title>Yellow Hand Shape 2 Hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-wooden-fancy-button-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-278--3.jpg?v=1663057638</image:loc>
      <image:title>Multicolor Wooden Fancy Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/penguin-shape-pink-2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-218-4.jpg?v=1663057709</image:loc>
      <image:title>Penguin Shape Pink 2 hole  Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-flower-printed-2-hole-wooden-fancy-button-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-584-_7B1_7D_aa25952f-f654-453f-a614-51b6b297f35f.jpg?v=1663057774</image:loc>
      <image:title>Multicolor Flower Printed 2 hole Wooden Fancy Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/penguin-shape-2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-221-2.jpg?v=1663062697</image:loc>
      <image:title>Penguin Shape 2 hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-mickey-mouse-2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-576-40l-5.jpg?v=1663062802</image:loc>
      <image:title>Multicolor Mickey Mouse 2 Hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-259-_7B3_7D.jpg?v=1663062983</image:loc>
      <image:title>Multicolor 2 Hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-dots-2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-262-_7B2_7D.jpg?v=1663063097</image:loc>
      <image:title>Multicolor Dots 2 Hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-hand-shape-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-296-2.jpg?v=1663065669</image:loc>
      <image:title>Pink Hand Shape Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-wooden-fancy-button-3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-268--2.jpg?v=1663065739</image:loc>
      <image:title>Multicolor Wooden Fancy button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-fancy-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-600-_282_29.jpg?v=1663065833</image:loc>
      <image:title>Multicolor Fancy Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/green-color-2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-141-_282_29.jpg?v=1663065895</image:loc>
      <image:title>Green Color 2 Hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-fancy-wooden-button-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-591_282_29.jpg?v=1663066378</image:loc>
      <image:title>Multicolor Fancy Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/floral-multicolor-2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-597-_282_29.jpg?v=1663066445</image:loc>
      <image:title>Floral Multicolor 2 Hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-2-hole-wooden-button-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-262-_7B2_7D_f634960e-01d1-40df-880d-3f7669265d9a.jpg?v=1663066514</image:loc>
      <image:title>Multicolor 2 Hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/floral-multicolor-2-hole-wooden-button-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-588-_282_29.jpg?v=1663066574</image:loc>
      <image:title>Floral Multicolor 2 Hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fancy-multicolor-2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-403-_282_29.jpg?v=1663066659</image:loc>
      <image:title>Fancy Multicolor 2 Hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/floral-multicolor-2-hole-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-403-_282_29_5261b09c-3d95-44cc-8644-c5384492ab6d.jpg?v=1663066715</image:loc>
      <image:title>Floral Multicolor 2 Hole Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-2-hole-wooden-button-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-329-_282_29.jpg?v=1663066793</image:loc>
      <image:title>Multicolor 2 Hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-fancy-2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-593-_7B2_7D.jpg?v=1663066934</image:loc>
      <image:title>Multicolor Fancy 2 Hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-2-hole-wooden-button-3</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-617-_7B2_7D.jpg?v=1663067050</image:loc>
      <image:title>Multicolor 2 Hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/micky-mouse-multicolor-2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-703-40l-5.jpg?v=1663067504</image:loc>
      <image:title>Micky Mouse Multicolor 2 Hole wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-floral-2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-95.jpg?v=1663067559</image:loc>
      <image:title>White Floral 2 Hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-floral-2-hole-wooden-button-1</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-86-_7B1_7D.jpg?v=1663067626</image:loc>
      <image:title>White Floral 2 Hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-color-2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-259-_7B3_7D_d756864d-2da0-4cce-986d-d2c176775023.jpg?v=1663067684</image:loc>
      <image:title>White Color 2 Hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/white-floral-2-hole-wooden-button-2</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-326.jpg?v=1663067733</image:loc>
      <image:title>White Floral 2 Hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/multicolor-2-hole-wooden-button-4</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-323.jpg?v=1663067846</image:loc>
      <image:title>Multicolor 2 Hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pink-kitty-2-hole-wooden-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-559-40l-5.jpg?v=1663067904</image:loc>
      <image:title>Pink Kitty 2 Hole Wooden Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/micky-multicolor-2-hole-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-465-40l-5.jpg?v=1663067955</image:loc>
      <image:title>Micky Multicolor 2 hole Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/micky-and-minnie-wooden-2-hole-button</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/cm-565-40l-4.jpg?v=1663068019</image:loc>
      <image:title>Micky and Minnie Wooden 2 hole Button</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/fevicryl-fabric-glue</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/Screenshot_2.jpg?v=1663072506</image:loc>
      <image:title>Fevicryl Fabric Glue</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/blue-gota-dori-work-embroidered-border</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/files/52C.png?v=1743576488</image:loc>
      <image:title>Blue Gota &amp; Dori Work Embroidered Border</image:title>
      <image:caption>blue-gota-dori-work-embroidered-border</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/black-multicolour-geometric-printed-satin-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/74a_5ce2a02c-0ce1-4bd5-8390-43584945e1a8.jpg?v=1764593601</image:loc>
      <image:title>Black Multicolour Geometric Printed Satin Fabric</image:title>
      <image:caption>black-multicolour-geometric-printed-satin-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/skull-printed-crepe-fabric</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/39b_7232fb34-7f46-4be5-b2e2-08d542af1c68.jpg?v=1753087838</image:loc>
      <image:title>Skull Printed Crepe Fabric</image:title>
      <image:caption>skull-printed-crepe-fabric</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/pigeon-blue-colour-glass-pearls</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1-37_8a322588-0c3c-4c36-ada7-bf0e9abc4b32.jpg?v=1663568622</image:loc>
      <image:title>Pigeon Blue Colour Glass Pearls</image:title>
      <image:caption>pigeon-blue-colour-glass-pearls</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-purple-colour-glass-pearls</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1_37_2_9a195817-c8d0-496e-bbfe-0100d15d2545.jpg?v=1663572569</image:loc>
      <image:title>Dark Purple Colour Glass Pearls</image:title>
      <image:caption>dark-purple-colour-glass-pearls</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-twisted-bugle-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1_32_11.jpg?v=1663573083</image:loc>
      <image:title>Silver Twisted Bugle Beads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/dark-gray-colour-glass-pearls</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1-38_8f0c33c9-1161-41f4-8c19-d28b57d6e9ab.jpg?v=1663573803</image:loc>
      <image:title>Dark Gray Colour Glass Pearls</image:title>
      <image:caption>dark-gray-colour-glass-pearls</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-color-twisted-bugle-beads</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1_32_13.jpg?v=1663581853</image:loc>
      <image:title>Silver Color Twisted Bugle Beads</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://thedesigncart.com/products/silver-color-bugle-beads-nalki-pipes</loc>
    <lastmod>2026-04-10T12:25:24+05:30</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/1950/2653/products/1st_5_160.jpg?v=1663582212</image:loc>
      <image:title>Silver Color Bugle Beads/ Nalki Pipes</image:title>
      <image:caption></image:caption>
    </image:image>
  </url>
</urlset>
